SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000281982 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000281982
Domain Number 1 Region: 61-230
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000475
Family GDI-like N domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000281982
Sequence length 437
Sequence
MLVLGQGFYVCMPIKSSNFMSKSSDHGLQFYNDVGVRWYGCRAMMLETVAVVPSMVTKVE
TISPPWDFVDTPCDYASYCGGCSQGSSNYMEALKSPLMGLIEKLIARKFILYVQDYSETD
PKTHEGMNLTRVTTRDLIAKYGLDDNNVDFIRHALALHRDDCYLNEPALDTMKRMKVEFN
EEGKVIGVTSEGETAKCKKVVCDPSYLPNKVRKVGKVARVIAIMSHPIPNTNESHSVLRV
CVEACKQNDDLSENYFFQVNDVWGGFGSNRFGFLPRMVVVLGLNAIVMVWTEIGLYIQEQ
FQGENLIDSVPWYEVLKDVVELRYTEGNRVVLFNCEWYDIVRKRTGYKIDHYGIISINTT
RKLNTKEPFVLANQATQAFYVREIKNKTWSYVVETKPRNVYEMPNVDDDDDEPYQEEEAH
GGIQANQNDDEDDEIVG
Download sequence
Identical sequences MDP0000281982 MDP0000281982|PACid:22629373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]