SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000282583 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000282583
Domain Number 1 Region: 1057-1348
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.24e-78
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 373-494,530-576
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.54e-27
Family Protein kinases, catalytic subunit 0.0039
Further Details:      
 
Domain Number 3 Region: 69-163,195-225
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 5.63e-25
Family alpha-D-mannose-specific plant lectins 0.0029
Further Details:      
 
Domain Number 4 Region: 680-789
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.83e-23
Family alpha-D-mannose-specific plant lectins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000282583
Sequence length 1393
Sequence
MGFRTETIGSIFGSTMFFLIFFILLLSQHHCAEVYEITPSQPFSQTQTLVSPSRXFELGF
FSPNGSVNKYVGIWHTNISPRKVVWVANRENPIAASDTLANLTISSNGNLELVDGKQNSL
WSTNISVPSNGSAAELLDNGNLVVKDDDVGADPLWQSFDYPSDTILPNMVLGFNSKSGKR
SLMKAWKSESDPSAGLFLAGLSRDVPSQVFIWINESKPYWRSGAWDKSMFIGVPDMDGQY
LSGFTLNADVNQGTKYFSYRFFDNTLSYFGISSDGVLSLKLSDNGSNWWLSWEALVNPCE
IYGTCGVNGVCKGSESPNPNCECLKEFEMETRLEDEGKPVKLIASVTAVGFIXILSAIVF
GVHKLRAKKPGKXQEGKETAVKRLSSSSGQGMEEFKNEMLLISKLQHKNLVRIMGCCVKD
DEKLLIYEFMPNKSLDTLLFDPKXREEXDWATRFNIIQGVARGXLYLHHDSCLKHAVQSF
GEHIYVPRYSKMVVKPXKDVSPEPTGKTRSSRFSEFETLPCADDPCRATAEILRQPFIYF
CMSPKYAMGAIFSEKSDVYSFDVLLLEIIANKKNTSFYCNEEQHGFLAHMLNIADSNNCR
QHSRYDFCRVRHLWNEGRGLDLLDEHHCAXVYEITPSQPFSQTQSLVSPSXLFELGFFSP
NDSVNKYVGIWHTNISPRKVVWVANRENPLAASDTLANLTISSNGTLELVDGKQNSLWST
NISVPSNGSAAELLDSGNLVVKDNDIGADPLWQSFDYPSDTLLPSMVLGFNSKSGKRNLM
KAWKSESDPSAGLFLVGLSWDVPSQVFIWINESKPYWRSGAWDKSRFIGVPDMDNQYLSG
FALHDDVNPGTKYFSYRFFDNTLSYFGISSDGVLSLKLSDHGSNWGLNWEAPVNPCDIYG
TCGVYGVCKGSESPNPNCECLKGFVPKSNXEWSNGNRTGGCVRTTELFCDQSNTSRSFAS
GGKEDGFRKMVGLKLPDFHELIENLEADECKIXCLNNCSCQAYAQVNNXGILSAIAFGVQ
RLRXXKTGNXKEKTKLMQXNHXSDNSRDNLQEYIXKHDPSELFIYDFDSILNATNNFSTX
NKLGEGGFGPVYXGKLQEGXEIAVKRLSSSSGQGIEEXKNEMLLISKLQHKNLVRIMGCC
VKDDEKLLIYEFMPNRSLDTLLFDPKRXAELDWARRFNIIQGVARGLLYLHHDSRLKVIH
RDLKVSNILLDENMNPKISDFGLARIVEATQSLANTHKVVGTLGYMSPEYAMGGIFSEKS
DVYSFGVLLLEIIAGKKNTSFYYNEEQHGFLAYVWHLWNEGRGLDLLDEVLADSYSSSEV
TRCMHIGLLCVQDKSEDRPIMPDVVFTLSSETXLPLPKQPIFSNFRNAVYNPQPQYDNIF
SANEETITIIEGR
Download sequence
Identical sequences MDP0000282583|PACid:22646622 MDP0000282583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]