SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000288439 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000288439
Domain Number 1 Region: 475-753,903-957
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.23e-43
Family FAD-linked reductases, N-terminal domain 0.0000085
Further Details:      
 
Domain Number 2 Region: 48-336
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.17e-32
Family FAD-linked reductases, N-terminal domain 0.0000645
Further Details:      
 
Domain Number 3 Region: 360-461
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 9.81e-21
Family GMC oxidoreductases 0.0014
Further Details:      
 
Domain Number 4 Region: 802-904
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 8.54e-20
Family GMC oxidoreductases 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000288439
Sequence length 961
Sequence
MGXFIVSVPPVCSSGPVLFMDSRIYSDFFLMAGQTLPRKTTSDVNQVSGKSFDYIIVGGG
TAGCPLAATLSEKFSVLLVERGGSPYENPLIMENKNFGLSLVQTDEYTSVAQSFVSKDGG
FQSPRKSSRRRIGYQRRIVSDAYKWVESRNAFKPKLTPWPYVAELSLLEAGIFPYNGFSL
DHIEGTKIGATIYDEQGRRHXSADLLMAGNPNNITLLLNATVTSIIFHKKGNRNVTVVRG
IRFIKSDGSSSQTHEAYLNTQNNSRSSTGDVILAAGALGSPQILLLSGIGPXKHLNKFDI
PVAVNLKSVGKGMQDNPSIALVPXVADAKPKNFPPDSPKVIAIADDFKLIVGSMILPISF
NATIMLISGKLAFPESEGQLELNSTDPRKNPSVTFNYLATEKDMAECVKLGRLLEQIVRS
KSIAYFLGVEGKRRNESMSTDDELRKLCKNNVRTFYHYHGGQTLPRKTTSDVNQVSGKSF
DYIIVGGGTAGCPLAATLSEKFSVLLVERDTRSYLDLSLFVSRVLSHLREKRRFTGKLGA
MASSSGTGAGRVLGGGSAINGGFFSRASXDYVKRVGWNKEMVSDAYKWVESRNAFKPKLT
PWQYVAELSFLEAGIFPYNGFSLDHIEGTKIGATTFDEQGRRHTSADLLTAGNPNXITLL
LNATVTSIIFHEKGSRYETIVRGIRFIKSDGSSSQTHEAYLNTQNNSRSSTGDVILAAGA
LGSPQILLLSGIGPQKHLNKFNIPVAVNLKSVGKGMTDNPCIALLAEIADAKPKNFPPDS
PKVTVIADDFKLVIQALILPXSFNATIMPIVGKLAFPESEGELELNSTDPRKNPSVTFNY
LAKEKDMAECVKLGRLLEKIVRSKSIAYFLGIEGKRRNXSMSTDDELRKLCKNNVRTFYH
YHGGCTMGSVVDKNYRVFGIXGLRVIDGSTFLESPGTNPMATLLMLGRYQGIKILQEREN
A
Download sequence
Identical sequences MDP0000288439 MDP0000288439|PACid:22643642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]