SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000297547 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000297547
Domain Number 1 Region: 464-727
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-74
Family Protein kinases, catalytic subunit 0.00015
Further Details:      
 
Domain Number 2 Region: 72-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.85e-24
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Domain Number 3 Region: 904-1019
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 7.46e-18
Family alpha-D-mannose-specific plant lectins 0.007
Further Details:      
 
Weak hits

Sequence:  MDP0000297547
Domain Number - Region: 349-421
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.002
Family Hairpin loop containing domain 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000297547
Sequence length 1110
Sequence
MDFVKGLLNVLVLQLLLLQLCSSLDTIKFDQPFRXGDFLVSKNETFVLGFFSPKMSTNSY
VGIWYNFSKDMVVWVANRDNPINGSSGVLSIGSDGNLVLQADTSEGLIPLWSTNVSISSA
SNDNIFAQILDSGNLVLAQQGSRHVFWQSTDHPTNILLPNTKMGLDRRSGINRFLTSWNS
ENDPGTGNVSLRIDPYGSPQLILYKNEAKLWRSGQWNGIQWSGIPDVPKDVFKINFVNNK
DEITSQWTDLDPSIYSVYTVDYSGTLNLRAWQRQQHQWVVLWSSQSYXXCNSYGKCGKFG
NCNXTESGFNCTCYPGYEPISPQDWDSKDGRGGCKRXQGSRSMCRSGEGFVKMKNVEVPD
TSSIKLEKNLSLEACEEECLKNCTCLAYAIEDVTNGGTGCMTWYRDLMDTKQFTXGGQDL
YVRADAVVLAQYKNKSVGGYFSGKRRLAIILVVSISVASMLILAVLCWFRKRSXKATENF
SSANMLGHGGFGTVYKGCLXXGQEIAVKRLSRNSGQGIDEFKNEVMLIAKLQHRNLVRLL
GCCIHKEERMLIYEYMPNRSLDLCLFDKNRKSLLDWRKRFQIIIGIARGVLYLHQDSRLK
IIHRDLKASNVLLDGSXNPKISDFGIARMFGDDQIEANTNKXVGTYGYMSPEYAMDGLYS
TKSDVFSFGVLALEIISGRKNSFQFENSPLNLVGIIWDLWTEGKVLDIIDSSLNQSYSXX
EVMRYIQIGLLFELYNGDECADGLACVLSVNVCLLQFVAFCAVENGFSRLAFSWCSDSHE
HIRFEYAAERLTMSAVVFMLVNEAAAPSPKQPAFLLELNITVETHHHNIEGENSANDVTS
HLSCDSSLFHFGCPRRHYTKPTLKRRRRSSLSTTKIFALGFFSPGNSHNRYIGVWYNNIP
IETIVWIANRENPVVPTAGTGLLAIHGDHGGLVIYWEDQNAPIWSANLTVSSPNNSVIAK
LWDTGNLVVVETNGSSSEKLLLQGFDYPSNTMLPFMKLGLDRQSGLNRFLTSWKSQDDPG
TGNCSYRIEPGESPLLFLYKGQTPLWRAGSWTGERCSGVPAMTKHFIFKAPFMNNEDEVS
VMYGIVDESVFSKMVIDESGILERSTWQDQ
Download sequence
Identical sequences MDP0000297547|PACid:22630158 MDP0000297547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]