SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000308870 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000308870
Domain Number 1 Region: 85-177
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000499
Family Thi4-like 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000308870
Sequence length 223
Sequence
MSFLYPARFSLKQTKMKSGGFNKNHRGMLWLHRAVDGRTEVLQLQLHHQAXEALPPRLPF
HGTPLVRRQPAKXAPASNRGLSVSMFANGLNPSYDLSAFKFDPIKESIVSREMTRXYXTD
XITYADTGVVVVDAGFARLSYTYEXNKNPDVQVAITEQSVSPSGGAXLGGQLVSAMDPDP
KPHMTSRQPTRKSGQPTRTXNKIFIENIYEKQLRNCNHQSSRS
Download sequence
Identical sequences MDP0000308870|PACid:22652882 MDP0000308870

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]