SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000310007 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000310007
Domain Number 1 Region: 380-629
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.81e-52
Family Protein kinases, catalytic subunit 0.00071
Further Details:      
 
Domain Number 2 Region: 71-179
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-27
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  MDP0000310007
Domain Number - Region: 242-287
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0961
Family Pan module (APPLE domain) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000310007
Sequence length 655
Sequence
MCMLIFYSSLLLIFAAVFSMADDATSTFQSIRDGETVVSTGGTFELGFCSPDASNRRYVG
IWYKHISVTTIVWVANRDKPLADLSGILKVTNPGILVLNHNMSTVWSSNTSRTAQNPVAR
LLDSGNLVVIDRSDDDSENFLWQSFDYPGDTFLPGMKIGRNTVTGFNWHLRSWKSPQDPS
QGNCTSQLGPKGYAELFVREGSXXKFRSGPWNGVWFSGNPQLNPNPIYTYSLVSEPDEIK
SWFKSMNLKECEMVCMKNCSCTAYTNLDIRDGGTGCLLWYGDLIXIRYIAENGQDIYIRM
AAAEQDFLSXKISFVDHEDNTKINAKYSESNAKKMRIIISTTMLSTGLLILGLALLFYVW
KKHHQKGGKLGHNQKEDLELPLFDLMTIVSATSNFSIENKLGEGGFGSVFKGTMEDGQEI
AVKRLSKSSRQGLDEFKNEVTHIAKLQHRNLVKLLGCCIQEDEMIXIYEFMPNKSLDFFI
FDFGLARSFGGNETTAKTKKVVGKYGYMSPEYVIDGFYSIKSDVYSFGVMVLEIVSGSRN
RGFSHPDHKLNLLGHAWMLHTKDMPLKLIDASVEDSVTLHEVVRTIHVGLLCVQRNPGDR
PSMSAVVLMLGGEGALPPPLKPSFYSERDLTELEVSHSSKACSANEVTISLVEAR
Download sequence
Identical sequences MDP0000310007|PACid:22671064 MDP0000310007

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]