SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000312097 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000312097
Domain Number 1 Region: 448-550,615-834
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 9.79e-72
Family Protein kinases, catalytic subunit 0.00029
Further Details:      
 
Domain Number 2 Region: 78-161,193-224
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 2.75e-25
Family alpha-D-mannose-specific plant lectins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000312097
Sequence length 845
Sequence
MNTKPNSKFVFSIILLCAFLESHVSLAADTISENQSLSGDQTIVSAGGMFELGFFKPGQL
SNYYIGIWYSKQVASEMTVVWVANREIPVSDRFSSVLTILDGNLVLLNMSKIPVWSTDLN
STTSSGSVLAVLLDSGNLVLIAGSSNNTSEPLWQSFDHPTHALLPGGKLGFNKITNHTQF
VTSWKNLEDPAPGLYSLELAPDESNSYILLWNRSRQYWTSGPWNESLHTFNVLPEMRIDH
NFIYNYVTNENESYFTYSSNNPKIVSQYSMSASGQIQLLWMENSKQWELFWSQPRQCDVY
ASCGAFSSCKPTSFNYCKCLKGFVPNRQSDWDLQIYSGGCSRRTSVTSNACSIWHGDVLN
LHEVEANEGDGSTLYVRAAASDIKEKRVIKPSLWIAIVSTITGLIVVVFGCFLWKKTTGK
KRKHKKNHTESKSKFDVGGGGGKDDAELPIFGLRAVVAATNNFAEADKLGEGGFGPVYKG
ILAESQEVAIKRLSKRSGQGHEEFMNELKLIAKLQHTSLVRLLGCCLEDEEMILIYEYMP
NRSLDKLLFGSMRWSYLLIRHAIGDWMSRFICDKILKPRGRLSITSRIASRYAANSFMSA
AGFVVKLLSASNPCEVAADVLLALCVARFSLCIAQGVLYIHKYSRLKIIHRDLKASNILL
DEGLNPKISDFGMARIFGINQIEANTNRVVGTYGYMSPEYARYGHFSEKLDVFSFGVLLL
EIVSRKKNAVFYRFEHSPTLAGWGWELWKEGRGMEVIDESVRETCQLYEALRCIHVGFLC
VQEAPADRPTMSSVIRMLQGNESTSLPPSKEPAFSTHRNSSHVRSSQTPTIYSHNAVTMS
LPEGR
Download sequence
Identical sequences MDP0000312097 MDP0000312097|PACid:22659342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]