SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000321182 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000321182
Domain Number 1 Region: 744-1058
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.72e-82
Family Protein kinases, catalytic subunit 0.0000976
Further Details:      
 
Domain Number 2 Region: 331-438
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-24
Family alpha-D-mannose-specific plant lectins 0.0033
Further Details:      
 
Domain Number 3 Region: 1143-1237
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 9.68e-20
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  MDP0000321182
Domain Number - Region: 603-656
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000785
Family Hairpin loop containing domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000321182
Sequence length 1329
Sequence
MSSVIRMLQSNEATSLPPSKEPAFSIHRGAGAVGCSSLTPASFSNNELTLCTKPYATKIS
KQTEGGFDFSGENDPSSNGNAYTVAYKFDDDEYVSYGVSGSSIKLRLKVNPTGRIDLLKW
TDDIVLGQNFKNNGIWGIGPVVVFQKRYRCANGEVFSKLEDVKLPDHGIMLENKVMSECK
SECLHNRSCTAYAYVSARTKQIWYGDLMDLVDNQLVGQRDIYIRVHGSQLSLFDQECNLR
SLSRLKKVMMFIRSRVCTFTSCADKLLLITSSSSPSPSGSLLDTLIPEESLSADQTLISS
SGTFALGFFSPENSKKFFLGIWYNQIPKNPKVWVANRGSPLDSPGVLMFSADGNLVVLDG
MTRKQVWSSNASIPASAMNATTAVLMDSGNLRLIFVQDVLWQSFHHPSDTLLPGMKLSLN
KITGQQSRLTSWAALDDPQPGMFSAGIDPKVPLQLIIWKGNATYWRSAVQFGKEVKRYFR
NQSGGFLSYNFDANEIDLTFGVSDSSLKLRVVLSPAGELNLQLWTESDTIKTWFKAWEEP
INKCDFYAACGPYGACDKNSDLLSSQCKCLKGFRTELHKQSAQGDWPGGCVREKALTCDK
GEGFEKFEKMKLPDHAIILGNMSTRECESECLRNCSCTAYAYSNVIKGGTVKCLTWLDDL
TDLVENHWLGQTMYIRVHRSDQGGKGHVDKLFLVIPIVSTTAGLLTIIFGYLLWKKTLRD
EGSVGRSISEAIRNFSLRGGKNDPELPLFSLRSLAAATNNFSEANKLGEGGFGPVYKGIL
IANEEVAIKRLSKKSGQGHQEFMNELKLIAKLQHTNLVRLLGCCIEDEEMILIYEYMPNR
SLDKFLFDSSERTKLDWRTRFRIIEGVAQGVLYIHKYSRLKIIHRDLKASNVLLDETMKP
KISDFGMAKIFGMDQTEANTNRVVGTYGYMSPEYALYGHFSEKLDVFSFGVLLLEIVSGK
RNSAFHRFEDPLTLAGWAWRLWKEGREIEVIDELLRETCQLDEDLRCIHVGLLCVQEAPA
DRPSMSSVICMLHNNEATSLPPFKEPAFSIHKSACAVGSSPQSSASHGYQNQAKFGAFSY
FLCLFLKLHVSSATDSVTANQSLSGDQTIVSAGGIFELGFFELGGRYYISTWYYNQVVSA
STIVWVANREQPVFDKFSSVLRILDGNLLPSNESKTPVWSTNVTSNNFSSVKAVLLDSGN
LAFFDESISSSEPLWQSFDHPTHTWLPGDKAFEDSKLGSSSSLRSKAASAISLSAIFMSC
EDFSFFFELDVLEDLDNLDFPLREDEGLMFDKDWVFFGISGNAFVVGGGDTIGPCSIRNS
DETKLIIFP
Download sequence
Identical sequences MDP0000321182 MDP0000321182|PACid:22682661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]