SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000459109 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000459109
Domain Number 1 Region: 46-154
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.53e-28
Family alpha-D-mannose-specific plant lectins 0.0041
Further Details:      
 
Weak hits

Sequence:  MDP0000459109
Domain Number - Region: 256-288
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0639
Family EGF-type module 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000459109
Sequence length 324
Sequence
MADDATSTFQSIRDGETVVSTGGTFELGFLQRYVGIWYKHISVTTIVWVANRDKPLADLS
GILKVTNPGILVLNHNMSTVWSSNTSRTAQNPVARLLDSGNLVVIDRSDDDSENFLWQSF
DYPGDTFLPGMKIGRNTVTGFNWHLRSWKSPQDPSQGNCTSQLGPKGYAELFVREGSVIK
FRSGPWNGVWFSGNPQLNPNPIYTYSLVSEPDEMSYSYKLHNSSIFSRLMLTSDGLLRRY
TWIDRTEGWVLYQTVQIDNCDNYAFCGVHGACNIQKSPVCSCLKGFTPKFPKEWDLVDWS
NGCVRKTSLNCTGDVFEKYEPQGM
Download sequence
Identical sequences MDP0000459109|PACid:22659504 MDP0000459109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]