SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000479466 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000479466
Domain Number 1 Region: 405-693
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.34e-75
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 
Domain Number 2 Region: 52-161
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-23
Family alpha-D-mannose-specific plant lectins 0.0042
Further Details:      
 
Weak hits

Sequence:  MDP0000479466
Domain Number - Region: 292-330
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0471
Family Anti-platelet protein 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000479466
Sequence length 849
Sequence
MASVTISPGQSLSGSQTITSPGGKFELGFFTPGNSQNYYIGIWYKNLANRTVVWVANRQQ
PVSEPKLSVLELVENGNLTLTSPSRVAIWSTNSRSMASNSALAKLLDNGNFVITDAFNSS
VVKWQSFDYLTNTWLPGAELGYNNRTKRKQVLTPWRNSKNPALGPFSFELDEIPLPYSIS
SYPDTFTRGTIEINGQLKFYAWDQGFRGWTLLSVEPSDQCAVQGSCGAFSICHQQSSPRC
GCLKGFEPKVRENWKLEDYSDGCVRKTPFHCSPGESYSFLTLTDVEKRYNKNFKENFYVS
IDQCRLECLINCSCTGFTYNSFDSGRCYMWIGDLYDIVATSESHSISYPPFVTGLNIXXV
DSTSEMKRKTTWIVIGVIAGFFSILSAATVVVFFRRRWSAGAFVTTDDFLVLYKHRDLRR
ATNNFSEKLXEGAFGSVFKGMLPNSTAIAVKELKSMNQGEKQFRAEVGTIGAIHHINLIR
LRGFCTNASKRFLVYDYMPNGSLHSLLLGNNPIVLDWKARYHIAVGIARGLAYLHEECRD
CIIHCDVKPENILLDSEYSPKLADFGLAKLLGRHHSRVLTTMRGTVGYLAPEWFSGEAIT
PKADVFSYGMLLIEVISGRRNMEGLDNGVENFRPLWLANAVNKVEDXFAVLDCRLEGQAD
GDELSRVCKVACWCIQEDEKDRPTMRQVVQILEGVSDIGTPPVPQFXQRLIKFPAEGINY
QETTSGSGAWLCSDVQSAFQAEVSNCATKSHEDQMKGVRVLIIDHGQVEQRNEEVVDGGL
LQRRELYASASSDDFHSYAYLALSLLILMKMEMVGDIGVGVAREGLDGRVGVGIDGEERL
RVISAVFGC
Download sequence
Identical sequences MDP0000479466 MDP0000479466|PACid:22663885

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]