SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000541805 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000541805
Domain Number 1 Region: 478-770
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.26e-77
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 81-197
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 4.21e-20
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000541805
Sequence length 846
Sequence
MALQTHISLSHLLLIAFLLSAAVSAASAATTISPGSSLSAANPNTAWSSPNDTFSLGFIS
SDPPTSPPSYVAAISYSGGVPVWSTGAGKVVDSGGTLQFLQSGTLRLVNGSGATLWDSNT
TSRGVSSAEIDDSGNLVLRNGTVTVWSSFDNPTDSIVPGQNFTVSKVLRSGLYSFKLVKN
GNLTLLWNDINVYWNQGLNSSVNTNLSSPTLGLRSIGXLSISDPQLSTDAIVAYSSDYAE
XGDILRFLKLGXDGNLRIYSSTRGSGTVTERWAAVTDQCEVFGYCGDMGVCXYNDXDPVC
GCMSLNFELVDPKDSRKGCKRKMEIKDCPQSVXMLDLEHTRFLXYPPETESQIFFAGISA
CRLNCLGSSACDASTSLSDGTGLCYSKTPGFLSGYHSPAMSSSSYIKVCGPVVPNPSSSL
GTAGNKKDWKLRAWIVVVVVIATLFGLMAFEGGLWWWFCRNSRSFGGLSAQYALLEYASG
APVQFSYKELQRSTKGFKEKLGAGGFGTVYKGILANRTVVAVKQLEGIEQGEKQFRMEVA
TISSTHHLNLVRLIGFCSEGRHRLLVYEFMKNGSLDSFLFATEEQSGKLLNWESRFNVAL
GTARGITYLHEECRDCIVHCDIKPENILLDENYNAKVSDFGLAKLVNPKDHRYRTLTSVR
GTRGYLAPEWLANLPITSKSDVYSYGMVLLEIVSGRRNFEVSEATNRKKLSLWAFEEFEK
GNIKGIVDRRLVDQDVDMDQVKRAIQVTFWCIQEQPSHRPMMGKVVQMLEGITEIENPPD
PRAVIEGSASGTSMTVSGNISPLSTAADSAPAPSSFSSFQISGVSPLTSGRNTEKATASL
IQSGPN
Download sequence
Identical sequences XP_008381017.1.92800 MDP0000541805|PACid:22654637 MDP0000541805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]