SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000545463 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000545463
Domain Number 1 Region: 488-665
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.82e-51
Family Protein kinases, catalytic subunit 0.00045
Further Details:      
 
Domain Number 2 Region: 63-210
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.57e-25
Family alpha-D-mannose-specific plant lectins 0.0035
Further Details:      
 
Weak hits

Sequence:  MDP0000545463
Domain Number - Region: 358-401
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0863
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000545463
Sequence length 699
Sequence
MACPLINLLFFLLMFLPFSTLAQTSKNISLGSSLTALKDGDLSWPSPSGEFAFGFREVAK
DGFLLAIWFDKIPNQTIVWSANRDKLVPKGSKVELTADGEFILNDASGEQIWSAESAGSG
VAYASMLNTGNFVLVNRSSSNVWESFSHPTDTILPSQTLNQNGILYARYTATNYSTGRFL
FSLKPDGNLVLATTKFPQNTPNEEYWSMENPNIGFQVIFNQSGLIYVTAKNGSLLSTISS
NMVSMKDFYQRATLEYNGVFRHYVYPKNTSSSSGRWNMTWSTSSYEPPNICTSIMESRGG
GACGFNSFCTIEDQGPTCQCPNGYSFIDPEDERRGCKQNFAPQSCGETSKEETDLFEFQE
LKNANCWGGDYALFESVSEDWCRQNCLDDCFCAAAVYNSGGQCWKKRLPFSNGAIDPSNT
GKTLIKVGKQNSTVKCGTNTEKKDHKTLILFGSAILSGSGVLNFLLPLITYLVVSRSYSR
KAKVSQTHPVISGVNLKHFTYEELNNATSQFKEELGRGGSAIVFKGVLASDNGKSVAVKS
LDARVGENDLEFKAEVSAIGRTNHRNLVQLLGFCYEGEHRILVYEFMSNGSLAGVLFGES
MPNWYQRRQIALEIARGLLYLHEESSSQIIHCDIKPQNILLDDSLTAKISDFGLAKLLRI
DQTLTMTRIREQKVMWPLNGSKGCLSRPRLIFTVTEFCC
Download sequence
Identical sequences MDP0000545463 MDP0000545463|PACid:22670248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]