SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000613541 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000613541
Domain Number 1 Region: 513-807
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.62e-75
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 80-230
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.9e-21
Family alpha-D-mannose-specific plant lectins 0.0025
Further Details:      
 
Weak hits

Sequence:  MDP0000613541
Domain Number - Region: 191-293
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.00864
Family alpha-D-mannose-specific plant lectins 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000613541
Sequence length 874
Sequence
MREVEGERYGIAERERVKGELRGRETKKKEERDGRLGTEIRGGVAVGNSLTATTSNSSSW
LSPSGDFAFGFLPLGGXDLFLLSIWYAKIQNQTVVWHAYEDNNPIVAPKGSTLNXNASXG
LVLNDPHGXEIWKSETTFXVVANGVMNDTGNFVLQDKNSGSLWETFNNPTDTILPGQTIE
RNGKLSSRQSESNYXKGRFQLRXQDDGNLVLNTINLPTDFANEPYFATDTTAGTXEGSEG
KQLVFNNSGXXFVXRENGGXFXLTXAGVSWVRDSYIRATLDFDGIFMLYSYPKNFTGIAS
WSPLWYQPNDICQALMEDTGVGVCGYNSVCKXNQDHRPTCECPRGFSFLDPKDLYRGCKP
DFIQGCEADEVQSPRKDLYDVEMQTNTDWPTSDYMRLKPFTAEKCKESCFQDCLCAVAVF
RSETCWKKKLPLSNGRVQFNLSSQTFIKVRKDNVTLQFPPMPIPPPMPIPDDKEKSKITV
IRVGSALLGTSIFVNVAALCLGFFFIFRKKPVRSSTDIVLDSNLRSFSYEELQEATNGFX
EELGKGAFGVVFKGAMQIGSGVEVAVKKLRYVMQDVEKEFKTELNVIGKTHHKNLVRLFG
YCDEGQQXXXVYEFLSNGTLASFLFSDXKPSWXQRIEIAYGIAKGLLYLHEECSTQIIHC
DIKPQNILLDDYYTPRISDFGLAKLLMMNQSQTHTAIRGTKGYVAPEWFRNLXITTKVDV
YSFGVVLLEIICCRRNVDVEGNLEERAILTDWVYDCYVEGVLDAVVDHEVEALGDRATLE
KFVMVGIWCIQEDPSLRPTMRRVVQMFEAVVEGGVLCKQFVXVPPYLARSXASPLAWLAV
AADLPRCKSWWSWLEFPNSQCGDEQLVDSVLKVG
Download sequence
Identical sequences MDP0000613541 MDP0000613541|PACid:22639032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]