SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000636166 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000636166
Domain Number 1 Region: 37-124
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.11e-18
Family alpha-D-mannose-specific plant lectins 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000636166
Sequence length 124
Sequence
MAYVTISPGQSLSGSQTITSPGGTFELGFFTPGNSQNYYVGIWYKNLQHGTVVWVANRKQ
PVSKLKFSVLELVENGNLTLRSPSKVAIWSANSRSKVFNSSAAKLLDNGNFVIRDTFNSS
VVIW
Download sequence
Identical sequences MDP0000636166 MDP0000636166|PACid:22644860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]