SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000672807 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000672807
Domain Number 1 Region: 72-118
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 0.000000000615
Family alpha-D-mannose-specific plant lectins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000672807
Sequence length 152
Sequence
MDFVKGLLNVLVLQLLLLQLCSSLDTIKFDQRIREGDFLESKNKTFVLGFFRPKMSNNSY
VGIWYKFSEGMVVWVANRDNPINGSSGVLSIGSDGNLALQADTSEGLIPLWSTNETLFWL
NKAAGMFFGRALITLQIFFFRIQKWGWTEEVA
Download sequence
Identical sequences MDP0000672807 MDP0000672807|PACid:22648635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]