SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000691114 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000691114
Domain Number 1 Region: 70-153,185-216
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 8.24e-25
Family alpha-D-mannose-specific plant lectins 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000691114
Sequence length 270
Sequence
MTLRFEDVTTGQRFRAEGQLTLSAKTNLSPAIKTIASAGGMFELGFFKPGQLSNYYIGIW
YSKQVVSEMTVVWVANREIPVADRFSSVLTILDGNLVLLNMSKNPVWSTDLSSTTSSGSV
QAVLLDSGNLVLRAGSSHNTSEPLWQSFDHPTHTWLPGGRLGFNKITDHTQILTSWKNLE
DPAPGLYSLKLSLDQSNSYILQWNRSKQYWTSGSWDDSSHIFNLVPEMRLNYIFNYSYVT
NENDSYFTYSLYDPRIVSRCTISAWGRFSN
Download sequence
Identical sequences MDP0000691114|PACid:22668399 MDP0000691114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]