SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000696847 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000696847
Domain Number 1 Region: 485-805
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.97e-73
Family Protein kinases, catalytic subunit 0.00024
Further Details:      
 
Domain Number 2 Region: 77-157,189-220
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.21e-27
Family alpha-D-mannose-specific plant lectins 0.004
Further Details:      
 
Weak hits

Sequence:  MDP0000696847
Domain Number - Region: 355-411
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.000345
Family Pan module (APPLE domain) 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000696847
Sequence length 836
Sequence
MDTKTKKRLVLSVVFFCFLKTHVSLAADSITANQSLSGDQTIVSAGGIFELGFFTPGNSS
KFYVGIWYTKQLVSERTIVWVANREKPVSDXFSSVLRISDGNLVLFNGSKIPVWSTNLTS
SSAATALLLDTGNLVLREGSSNSTSEPLWQSFDHPAHTWLPGARIGFNTVTKQTQILTSW
KSSEDPAPGLFSLELDPKGSHAYFIRWNRSRQYWSSGPWDSKSKLFSWVPEMRLNYIYNF
SFVTNATESYFTYSLYDPKIISRFVLNTSGQIQQLTWLEPSRQWNXFWSQPRQRCEVYDL
CGAFGTCNDVSTVSCNCLNGFEPKAKRDWDLQDYSGGCKRKTDLHCENATSASGKLDRFL
ELPSMSLPENEQSVEVGNIAECESFCLRNCSCTAYSYNASGCSIWEGELLNLQQLTSSVD
HGITLYLRLAASEFKNSKSNNKGLIVGVAAGSAAGVAVLLGLIVFVILGQRKRVNGMGKA
VEGSLMAFGYREMQDATKNFSEKLGGGGFGSVFKGTLPDSSVIAVKKLESVSQGEKQFRT
EVSTIGTIQHVNLVRLRGFCSEGAKRMLVYDYMPNGSLDSHLFNDQHPNVLNWRTRYQIA
LGXARGLAYLHEKCRDCIIHCDIKPENILLDAELCPKVADFGLAKLVGREFSRVLTTMRG
TRGYLAPEWISGVAITVKADVYSYGMMLFEFVSGXRNSEQSEDGKVRFFPTSAASKISNP
ESDVLSLLDPRLDGIADVEELTRICRVACWCVQDDEARRPSMGQVVQILEAVSDVNLPPI
PRALQLLGDDQEQIIFFTESSSSQSSRPRSNNRXTASSQTKNSPSSTISKRSEEHQ
Download sequence
Identical sequences MDP0000696847 MDP0000696847|PACid:22626934

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]