SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000769741 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000769741
Domain Number 1 Region: 28-322,422-457
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.26e-68
Family FAD-linked reductases, N-terminal domain 0.003
Further Details:      
 
Domain Number 2 Region: 304-409
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 2.89e-24
Family L-aminoacid/polyamine oxidase 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) MDP0000769741
Sequence length 490
Sequence
MASGSKSNHQLRRALCSNGEKRQRSAPSPSVIVIGGGMAGVSAARALHDASIQVVLLESR
DRLGGRVCTDYSFGFPIDLGASWLHGVCKENPLAPLIGRLGLPLYRTSGDNSVLYDHDLE
SYALFDMDGNQVPQDLVTKVGEVFENILKETDAVRQEFSEDMPIARAFSIVFERKPELRL
EGVAHKVLQWYLCRMEGWFAADADTISLKCWDQEELLPGGHGLMVRGYLPVINTLAKGLD
VRLSHRVKKXTRRYNGVKVTVEDGRTFVADAAVVAVPLGVLKAKSITFEPKLPDWKEAAI
EDLGVGIENKIVLHFENVFWPNVEFLGVVADTSYCCSYFLNLHKATGHSVLVYMPAGQLA
KDIEKMSDEEAANFAFTQLKKILPDASTPIQHLVSRWGSDVNTLGSYSYDMVGKPHDLYE
KLRVPVDTLFFAGEATSVDFPGSVHGAFATGAMAAEDCRMRVLERYGELDLFEPVMGEEA
MSIPLLISRL
Download sequence
Identical sequences MDP0000769741|PACid:22637873 MDP0000769741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]