SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000771633 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000771633
Domain Number 1 Region: 44-207,294-398
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.75e-36
Family FAD-linked reductases, N-terminal domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000771633
Sequence length 450
Sequence
MATATQATLSLFAAPLPAKPRSLTIRCLKSTTRTTNPPIVGRKLRAAVIGAGPAGSSAAE
ALATGGVECFMFERSGPSTAKPCGGAIPLCMLDEFDIPSHLIDRQVTRMRIFSPSNLAVD
FGKTLLPHEFIAMLRREVLDSYLRTRAQSRGANLISGLVTDLEVPTSVDAPYVISYTADN
KRESLAVDVVIGADGANSRVAKSIKAGDYACAIAFQERIKLPDDKMDYYQDLAEMYVGND
VSPDFYAWVFPKCDHVAVGTGTVCSKQDIKVFQRAIRARAHSKISGGKVIKVEAHPIPEH
PRPTRVRGRVALVGDAAGYVTKCSGEGIYFAAKSGRLCGEAIVKASEGGERMINEGDLKR
EYLKEWDGKYITTFRFLDLLQKVFYGSDAAREALVELCGDEYVQRMTFESYLYKKLADGN
RWEDAKMVLNTIGSLVRCNILGTKMEGLKL
Download sequence
Identical sequences MDP0000771633 MDP0000851102 XP_008378886.1.92800 MDP0000771633|PACid:22649768 MDP0000851102|PACid:22674240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]