SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000795740 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000795740
Domain Number 1 Region: 19-60,189-241
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.00000000000751
Family FAD-linked reductases, N-terminal domain 0.012
Further Details:      
 
Weak hits

Sequence:  MDP0000795740
Domain Number - Region: 17-96,130-163
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 0.000842
Family FAD-linked reductases, N-terminal domain 0.066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000795740
Sequence length 247
Sequence
MIASWMHAVVLNILNRSGGNGDVVAIKTSRNTLHCKKAIVVAAGCWSGSLMRDLLKESEI
VLDVPVKPRKGHLLVLENFNSFHLNHGLMEVGYVDHQTANPLPSISTSELLNQDEQSLSV
SMTATMDTMGNIILGSSRQFAGFCTELEESIIIRIWERAGEFFPKLKXKLFSDISKGREV
RVGLRPYMPDGKPVIGPMPGLANVFLATGHEGGGLSLALGTAEMLTDMVLGNSEKVNSAP
FTVHGRC
Download sequence
Identical sequences MDP0000795740 MDP0000795740|PACid:22666880

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]