SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000814899 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000814899
Domain Number 1 Region: 476-775
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.16e-79
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 76-184
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 3.8e-27
Family alpha-D-mannose-specific plant lectins 0.0038
Further Details:      
 
Weak hits

Sequence:  MDP0000814899
Domain Number - Region: 350-405
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.0235
Family Hairpin loop containing domain 0.057
Further Details:      
 
Domain Number - Region: 32-91
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0465
Family V set domains (antibody variable domain-like) 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) MDP0000814899
Sequence length 808
Sequence
MVFKLLLHVVFLLLIVLFPFCTSIDTIAFNQQVKDGDFIVSKEGNVELGFFSPGNSSSRY
VGIWFAQKYEKGQKVVVWVANRNNPINDTSGVLTIDRHGNLVLYALENISIWSAYVSVQT
RSTSVAQLLDSGNLVLFQDNRSDSFIWQSFDYPXDTLLPGMKVGLNWKKGLEWILTSWKS
EDDPSTGDYSYRLFSNQTAIPHYFVYKGLAKYWRSNPGPWPNYVSNSEEKYYFLVNDNTS
VIRTVLRHYGSYQQLRWNDGDDEWEELWEVPKYRCDKYGQCGPNSRCSPENILFECECLP
GYEPKSVNNWNRRDGSDGCVSKRIGVSKCGNGDEFVKVVRVKDPDTSRAAQLLTNISANE
CEQVCLSNCSCTAYLRAEWEGRSDCLFWYGDLMDILVRTELGRDIYVRVDKVELDQNTRK
SKGFLRRRGLLAIPIVFVLMAFVLIIVFACWKLKKKRKTEDFVGADELEATRRHPELQLF
DLSTIIAATDNFSPTSELGRGGFGTVYKGQLPNDQIIAIKRLSRTSGQGVEEFKNEVALI
ARLQHRNLVKLLGCCIKGEERMLVLEHLPNKSLDSFLFDHRKRSLLDWKKRFEIINGVAR
GILYLHQDSRLRIIHRDLKTSNILLDSEMNPKISDFGMARIFHGDQLQDKTNRVVGTYGY
MSPEYVVFGRFSTKSDVFSFGIILLEIISSKKNNGVYQDDHSINLIGNVWQLWREGRPLE
IVDSSLESFPSDEVMRCIQVGLLCVEEDSKDRPSMSTVVFMLSGETSPPSPKQPAFVFRK
SSCDDADPLIPKGSDSMNGLTITAFEAR
Download sequence
Identical sequences MDP0000814899 MDP0000814899|PACid:22635740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]