SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000829384 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000829384
Domain Number 1 Region: 15-357
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.53e-33
Family GDI-like N domain 0.00019
Further Details:      
 
Domain Number 2 Region: 381-497
Classification Level Classification E-value
Superfamily FAD-linked reductases, C-terminal domain 0.00000000000267
Family GDI-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000829384
Sequence length 566
Sequence
MSDSSLYDPIELETTTFDLIVVGTGLPATIIAAAASASGKTVLHLDRNHFYGSQFASLQL
DELTSFIKSHATPPSTIIGSTSTGSSLDYTALDVTLRSVYSNIETANYAPEILANQFSKF
LIDLGGPRXLFCADKAIDLIAKSGVGSYLSFKSIDVSFICDENGRLSNVPDSRSAIFKDK
SLSLIEKNQLMRFFKLVQQHLAASAGDDGGNESAKISEEDLESPFADFLKRMRLPPKIKS
SILYAISLADDDQDNSEVCKTVLKTREGMERLDLYQKSVGRFPNVPGALLYPLYGHGEIL
QGFTRRAAVKGCIQVLRMPLTALLMDKQTGQYKGVRLASGEEIFSHQLLLDPTLTVPLPP
ASSSPNLEETLQVLSLKGDKRKVARGICITTSSLKPDVSNCLLVYPPRFLFSEQDTSIRA
IQIGGGSDKLAVCPSGMFVLYFSGLCDDAEHGKRLLHAAMNALLTLPVSANRESGSAVQS
EDADVKPTLLWSTLYIQELTTAHNGECENIFFTPMPDGNLNYNDLVDSTVALFQKMYPDE
VFFAETPSSPVEPDNPEDDTELSLDS
Download sequence
Identical sequences XP_017186746.1.92800 XP_017186747.1.92800 MDP0000829384 MDP0000829384|PACid:22650105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]