SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for MDP0000939633 from Malus x domestica

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  MDP0000939633
Domain Number 1 Region: 205-319
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.97e-30
Family B3 DNA binding domain 0.00000461
Further Details:      
 
Domain Number 2 Region: 76-133
Classification Level Classification E-value
Superfamily DNA-binding domain 2.42e-17
Family GCC-box binding domain 0.00095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) MDP0000939633
Sequence length 401
Sequence
MDGXSSTEESTTSDSISXSPPHHIVTRVEPLAKSAPQVDSLCRVGSGASSVILDSDLSSG
GGTGGVEAESRKLPSSKYKGVVPQPNGRWGAQIYEKHQRVWLGTFNEEDEAATAYDVAAQ
RFRGRDAVTNFKPSSDDEENDXVEAAFLSSHSKSEIVDMLRKHTYNDELEQSKRNYFSYG
KRGXSNGPLGLFGTDNSRVQKAREQLFEKAVTPSDVGKLNRLVIPKQHAEKHFPLQSGST
ATITVSASSACKGVLLNFEDVGGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKNLKAGDIV
SFQRSTGPDKHLYIDWKTRMSVYNNSNGSNPVQGQXAPVQMVRLFGVNIFKIPGSSGAGP
VDAAAAAAIGGGCNNNIGKRMREMEFLKLEFSKKPRIIGAL
Download sequence
Identical sequences XP_008339704.1.92800 MDP0000939633 MDP0000939633|PACid:22667205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]