SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc00g025500.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc00g025500.1.1
Domain Number 1 Region: 138-273
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 1.41e-22
Family GntR ligand-binding domain-like 0.015
Further Details:      
 
Domain Number 2 Region: 69-136
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.76e-16
Family GntR-like transcriptional regulators 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc00g025500.1.1
Sequence length 378
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch00 gene_region:12282102-12283461 transcript_region:SL2.40ch00:12282102..12283461- go_terms:GO:0005622 functional_description:"Transcriptional regulator GntR-family (AHRD V1 ***- A9I3B6_BORPD); contains Interpro domain(s) IPR011711 GntR, C-terminal "
Sequence
MAGQPGHSADQGRQSRSVPPHAAGRYENLGADRQGFRRTRRLSASVRHWLPVLYTPPSTV
PNSAAVTDSVVEQVYDKLKQMSVGYDFKPGERLNEGVLASALGVSRTPLREALTRLTTEG
LLRFSPGKGFFCRDLDAQEVFSLYEMRRIVETEALRLSIERAKDADIDALLAFLESTGPE
PGDRSVEELVRLDETFHEGLMAMSGNMEMLRVLKNINARIRFVRWIDMERCDRRVSQNDH
RDILLGLKARDPDRCIPILSKHIERRHDQISAALKEAGGRGCVALTSACAGGALRNTVAS
RCGSPMPRWVLKTCGRLPVSAAAFATEPNVAIRMIAVNLSISTPRSGIAYVGSSALARTG
SRYGCNGHVQVTPMRVGX
Download sequence
Identical sequences Solyc00g025500.1.1 Solyc00g025500.1.1 Sopim00g025500.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]