SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc00g065930.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc00g065930.1.1
Domain Number 1 Region: 470-553
Classification Level Classification E-value
Superfamily AF2212/PG0164-like 0.00000000000000207
Family PG0164-like 0.0005
Further Details:      
 
Domain Number 2 Region: 365-424
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.000000000139
Family Viral proteases 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc00g065930.1.1
Sequence length 622
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch00 gene_region:14375991-14378097 transcript_region:SL2.40ch00:14375991..14378097- go_terms:GO:0003824 functional_description:"Peptidase family S46 dipeptidyl-peptidase 7 (AHRD V1 ***- A5FMW8_FLAJ1); contains Interpro domain(s) IPR019500 Peptidase S46 "
Sequence
MILGYPGRTNRYLTSYGIQQMVNKDYPAWVEASKLAMDIMKKYMDKDKGTQLNYASQYAS
VANYWKNRQGTIDAVIKNGTITDKQKVEERFKTWAVQPENIVQYETVLEDIGIYYKQTSE
RNVERMYMSQLSRNAKYFSLALQVGSVLKAYADQDMAGRLAMKPKVDAALKSAYENINTQ
LEGEMLNSMVNLYQTKVNKDVASETIMGLDAKNLSNVAYSSIFANKTSATNFVLNPDKLK
LDADPLWKIANGLVADQRASAERFVKIDDNFAKNNRLFLAGLMKAMPEKKFYPDANSTMR
LTYGTVDALPIRTDRNYFGVTENYYTDMAGLVGKYKKGDEEFDLPQRVIDLYNLKDFGQY
ADAKGYMPVNFLSNNDITGGNSGSPVIDGDGNLIGIAFDGNSEALSGDIVFEPEWQKTIN
VDVRFVLWTIDKYAGARRLIDELQLVRDENTPADTKTKMPKATPMKLQPIQFKAIIKQHG
TMNAAFVEFPFSAEELFNKKGQVKIKALFDDKVEYRGSLAKMKTAFHLLILTQEVRKQLE
KTFGDEISVSLTEDKEERTVEISDDILTVFNENPEAKTLFDKMSYTHKKEYIRWINEAKK
PETRENRKSKMIQMILEGKKGV
Download sequence
Identical sequences Solyc00g065930.1.1 Solyc00g065930.1.1 Sopim00g065930.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]