SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g009820.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g009820.2.1
Domain Number 1 Region: 27-226
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.4e-26
Family BAR domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc01g009820.2.1
Sequence length 632
Comment genomic_reference:SL2.40ch01 gene_region:4260281-4266897 transcript_region:SL2.40ch01:4260281..4266897- functional_description:"Hydroxyproline-rich glycoprotein family protein (AHRD V1 ***- D7LGA9_ARALY)"
Sequence
MKTSLKKLRGLATLRHERKERRLRQPSDELAMAAQDMQEMKDCYDRLLSAAAATANGAYE
FSESLREMGDCLLEKTALNEDEESGKVLLMLGKLQFQLQRLVDNYRSHIIQTISVPSESL
INELRVVEEMKMQCDDKREVYEKMMQKHRDKGRVKGSKGEHISSHQLQVAYEDYDEGANV
FVFRMKSLRQGQSRNLLTQASRHHAAQLSFFKKALKSLEEIEPHVKLVTELHHIDYHFRG
LEEDDGVNAGNDNENSSEDDSDVGSESLDDGELSFDYGQNDQVYTSTHSMELDKVDVAVS
EVASKGASKENLSKIHGGNSFSFFRDVNITKSAPLLSGRKPDPAEGAARMTSSLSNKFQP
YVLPTPVEVKIPESVKSHNIDLQTKRTSQTSGVVQKWHSSPLDQFKYEKLMAGDKFPGPI
TVNTQSVPTESKNNASTGWLPPPLSEGLSSAQRDLSNAKKVKRQAFSGPLTAKPWPKKPI
VSSGSPIASSGYPLHFSLPFLHTSTPEPSSTPKLSSRASLMSSPKISELHELPRPPAKIT
TTRPLRPVTRSGPLVSKVQDFSPTNKAAVSSAASTLPTPPALPRSYSIPSRGQIETSLHV
SKPLEDMTSSPPLTPIALVKDRHTSPASQPPS
Download sequence
Identical sequences K4ATH7
Sopim01g009820.0.1 Solyc01g009820.2.1 XP_004228436.1.44838 Solyc01g009820.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]