SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g068270.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g068270.2.1
Domain Number 1 Region: 353-644
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.02e-73
Family Protein kinases, catalytic subunit 0.00012
Further Details:      
 
Domain Number 2 Region: 54-174
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000117
Family Universal stress protein-like 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc01g068270.2.1
Sequence length 717
Comment genomic_reference:SL2.40ch01 gene_region:69799290-69803691 transcript_region:SL2.40ch01:69799290..69803691+ go_terms:GO:0006950,GO:0006468 functional_description:"Receptor-like kinase (AHRD V1 *-*- A7VM42_MARPO); contains Interpro domain(s) IPR002290 Serine/threonine protein kinase "
Sequence
MKVCNGNCSCTVERDDCNTTTTSSVDDSNTMTGSVSISDGDDGAGDVGGRVVAVVGVKLD
SRSKELLTWALVKVAQTGDHVVAVHVIDPNSDKSEPLSLVKSFDSMLSAYEGFCNLKQVH
LKLKVCRGSPVRKVLAREAKLESAINLIIGTSGSHHAIRSSVSLAKYCARKLTKNISVIA
VDNGKIVYQREASALDGDESSDSDMPRSRFKRRKTLNKSPLSSMPRKVVEENSCTTENNY
MALVPVKPIEVRESKSRWTLLRRVFLQNLVAPDKFPAKRSSVIHWVWKRPSRQSFAAIYP
DHKQSVSDKDEPHHTNLDAEKGAIIPVGSDANPISNEFIILPEELEGLSERYSSMCRLFN
YQELCSATSDFLPENLIGKGGSSQVYKGCLPDGKQLAVKILKPSEAVAQQFRSEIEILTT
LHHKHIISLFGFCLEENNLLLVYDLLSRGSLEENLHGSKKDENTFSWVDRYKVALGVAEA
LDHLHNAADGPIIHRDVKSSNILLSDDSEPQLSDFGLATPASSCSNHLDSIDVAGTFGYL
APEYFMHGKITEKIDVYAFGVVLLELLSGKKPIDNGNGKGQESLVMWAKQVLKGGNTKEL
LDPSLIDTCDHDQFERMVSAASLCIRRAPGIRPQIDIVLKLLQGEAETIKWAMEEGKTSE
EVDAVDGEQPPSNIQSFINLALLNLEDESSLSCTSTGPTISVEDYLQGRFSRSSSFD
Download sequence
Identical sequences K4AX74
Solyc01g068270.2.1 XP_004229167.1.44838 Solyc01g068270.2.1 Sopim01g068270.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]