SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g098280.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc01g098280.2.1
Domain Number - Region: 23-96
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0275
Family PB1 domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g098280.2.1
Sequence length 335
Comment genomic_reference:SL2.40ch01 gene_region:80619012-80620301 transcript_region:SL2.40ch01:80619012..80620301+ functional_description:"Heat shock protein DnaJ (AHRD V1 *-*- A2Q3G0_MEDTR)"
Sequence
MGAENKTLFCYCRWGWTEKVLPDGTTLYVGGITRQVTVKTRIKYNDFVNTVFDRLGIADP
SDKILQFTAKFCKSRLIDLRDQKDVNAMFQFNDGSADVYVSSLVKEPNSRPASGSGKTVE
LAVVSESKPDTHVRDDENDLATPLKKARCIQSAGDSLERLNQNGADLPVGDVQNNSSKQA
SIPPSGDGNVIVISDSEPDTTPDVNKQASIPPSFGTYYVNPKELYKFPHRIPSFKMTGNE
GKGVPAGSFELYPYSLPLNPNDTWYPGKVKETANSRPVEDVSSAVPSGSKEKSSTSEHAS
TSQMTGNLNGVHAANEELPMTSDLELKLWFGETKK
Download sequence
Identical sequences K4B0L5
Sopim01g098280.0.1 Solyc01g098280.2.1 Solyc01g098280.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]