SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g098310.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc01g098310.1.1
Domain Number - Region: 87-147
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0432
Family PB1 domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc01g098310.1.1
Sequence length 456
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch01 gene_region:80635307-80639639 transcript_region:SL2.40ch01:80635307..80639639+ functional_description:"DNAJ heat shock N-terminal domain-containing protein (Fragment) (AHRD V1 *-*- D7L312_ARALY); contains Interpro domain(s) IPR015609 Molecular chaperone, heat shock protein, Hsp40, DnaJ "
Sequence
MTGTEREGVPSGSFELNPASLPLSSDDIWYPVNVKEDHRTTNSEPVENVLSEFLLELVML
LCLCHWGRKTKMLPDGSILYAGGITDQFVVETSINYNDFVKAVFDRLGIDSSDKMLHFTV
KFDRSEPIRLRDQQGVDTLLQFNDGFAHVYVSSLQEEPYSITPSVGARKVELDVVSYSGQ
NTTPAGDDENNLESALEKARFQSAGDSSKPLKEAIANQSAGDREPQQKEAVGVDDQKIIW
AVYDDVHDAMPRKYVRISKVFGPEFKIMFRWLEPLPDEDQRECAWVKSGCGKFISGDIHS
TSDRFSFSHQMHCKEGTSDMYILYPRKGEIWALFKAQDILWSPLSHSEPKYEVVEILSDF
VKNAGVRIGYLDKVTGFAGIFQRTKLFVSSSFVIKPNELYKFSHRILSFKMIRTEGTGVP
VGSFELDTASLPLDPNDIWYPGKVKEELGLAKLGIR
Download sequence
Identical sequences K4B0L8
Sopim01g098310.0.1 Solyc01g098310.1.1 Solyc01g098310.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]