SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g098340.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc01g098340.2.1
Domain Number - Region: 23-96
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0226
Family PB1 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc01g098340.2.1
Sequence length 800
Comment genomic_reference:SL2.40ch01 gene_region:80648857-80652917 transcript_region:SL2.40ch01:80648857..80652917+ functional_description:"DNAJ heat shock N-terminal domain-containing protein (Fragment) (AHRD V1 *-*- D7L312_ARALY); contains Interpro domain(s) IPR015609 Molecular chaperone, heat shock protein, Hsp40, DnaJ "
Sequence
METEDKTLFCFCHWGKKNKVLPDGSASYVGGITRQVIAKTGIKYEDFVNAVFHRLCIDPS
DKILHFTVKFDRSQLIQLSDQEDVNTLLQFNDDFAHVYVSSSEMEPHSRLPSVGAKKIEP
VVFDLELDTNPVRNDENDLASPLKKAQSNQSAGDSNPLKRSWAHQSIKDSKPQKKEAVAS
EQASRLPSGGAKKVKLTIDSDSDSGSDSESESESDTVPDGNLPEVYDYPDPEFSVFDKHK
AQNCFAIDQIWACYDTADGMPRFYAHIRKVYSPEFKVMFSWLDAYPEDERSRAWVGAELP
VGCGKFRRGSTEFTSDRLTFSHQVQCGMGKRGLYIVYPRKGETWALFKNWDMSWSSDPDN
HRKYKYEIVEIVSDYVVDVGVLVGYLDKVSRFVSLFQRMRPTEVGTFFVKPNELYKFSHQ
IPSFKMTGTEREGVPAGSFELDPASLPLSPDDIWYPGKVMEDSRAVNSEPVENDLPAVPL
GARDKSRKATTSLKSGDDIHATDGESSKVQITPKKMNISEKKRTQMSSSSANDSPSTDFD
DNCVKKSRHSSPRMPIHLSCQGDRELHSCRKSFGLSNSVGSSKKISTFSVDKGFEETFCD
FEMDRSTGKFQINQVWAIYGQNSTLPNTYALVKKIVPAPFKLHVVLLESCAGPKNAAQSV
CGTFKVQNEKHQAYDSSSFSHVVKAISTKNRFEIYPREGEIWALYKSLRKSGLDPDKFEY
DIVEVIEYSKEWIKVSSLVRVDGLKSVFKQQTSNSVTLEIQKDEFWRFSHQIPAFQLTGE
KGGVLRGCWELDPAAVPCSL
Download sequence
Identical sequences K4B0M1
Sopim01g098340.0.1 Solyc01g098340.2.1 Solyc01g098340.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]