SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc01g105680.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc01g105680.2.1
Domain Number 1 Region: 35-131
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000022
Family BTB/POZ domain 0.0078
Further Details:      
 
Weak hits

Sequence:  Solyc01g105680.2.1
Domain Number - Region: 557-624
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.068
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc01g105680.2.1
Sequence length 669
Comment genomic_reference:SL2.40ch01 gene_region:85527440-85530485 transcript_region:SL2.40ch01:85527440..85530485+ go_terms:GO:0005515 functional_description:"Phototropic-responsive NPH3 family protein (AHRD V1 **-- D7KEU3_ARALY); contains Interpro domain(s) IPR004249 NPH3 "
Sequence
MWESENESVGGRDYGNGVHSTSKNGVKTDSFEQKGQSWYVATDIPSDLLVQIEDVTFHLH
KYPLLSRSGKMNRIIYESRDAELNKISLNELPGGPEAFELAAKFCYGIAIDLSATNISGL
RCAAEYLEMTEDLEEGNLIFKTEAFLSYVVLSSWRDSILVLKSCEKLSPWAENLQIVRRC
SESIAWKACANPKGIKWQYTGKPASVSSPSWNQMKDSSPSRNHQVPPDWWFEDVTILRID
HFVRVITAIKVKGMRHELIGASIMQYATKWLPGLIKEGSGLAEDGCNSSNSNGSSSWRGG
LHMIIAGSGEEIPTVQAKDQRMIVESLISILPQQKDSVSCSFLLRLLRMANMLKVAPALI
TELEKRVGMQFEQATLADLLIPSYHKSETMYDIDLVQRLLEHFIIQEQTESSSPSRYPFH
DKHMQDGSQRGTNLNAKMRVARLVDSYLTEVSRDRNLSLTKFQVLAEALPDSARTCDDGL
YRAIDSYLKAHPTLSEHERKRLCRVMDCQKLSVDACMHAAQNERLPLRVVVQVLFSEQVK
ISNAIANISLKDEGETHYQPLVSHHKSLLEATPQSFQEGWTAAKKDINTLKFELETVKTK
YVELQNDMVDLQRQFDKIAKPKQASAWTAGWKKLSKLTKTTNVETHDISSQIPNAEQTTK
PRRWRNSIS
Download sequence
Identical sequences K4B2D8
XP_004230550.1.44838 Sopim01g105680.0.1 Solyc01g105680.2.1 Solyc01g105680.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]