SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g031860.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g031860.2.1
Domain Number 1 Region: 1012-1210
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.28e-53
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 193-281
Classification Level Classification E-value
Superfamily CAD & PB1 domains 5.33e-20
Family PB1 domain 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g031860.2.1
Sequence length 1221
Comment genomic_reference:SL2.40ch02 gene_region:17793182-17800827 transcript_region:SL2.40ch02:17793182..17800827- go_terms:GO:0004712 functional_description:"Serine/threonine protein kinase (AHRD V1 *-** C4PKQ3_PRUPE); contains Interpro domain(s) IPR002290 Serine/threonine protein kinase "
Sequence
MDRDFEQNNFEQARYSSIDTRAEVIGSSNQKFFQDPSSSINTDIRPPDFTIPVAARPVMN
YSIQTGEEFALEFMRERVNPKQNLIPHASGGTAGATSCMDLKDKSGISHTGSESGSDIAM
ITSVGKTRVQHHGRSTSVNEGISNHQAVQTETRALSRNNNIHGIQSQMSSRSSTLTKLKF
LCSFGGRIMPRPSDGKLRYIGGDTHLVRLRNDVSWEEFWQKMLTLFNNCHTIKYQLPGED
LDALVSVSCDEDLQNMIEEFNVLEGDGSQKLRTFLFSYSDLDDSLAGLENIEGDPEMQYV
IAVNNMDFGSRRNSTALASTSEKNLDEFLSATIAGEDGQVARHVAGADTSDPVIGMPLTS
QSAHEGVSISSHRILGSNLGHDSNQLEYLGQTVHHGGTEWQPLPSSIPVDNFPGVGGKNL
VLPSKQVQYNHGYQLPNSSQLTNNFLISSSHGYMNWKGGIDPKQSYESSHMNDQESHATV
VNLKRDNYPREIFELSKAKPREKEVPEEGNIKVESSFQKINEPEKLWPLECKKVVSSNPL
NDSASSHVSRVEVPNFTASAVVGNDVMQSKINEKSQEEVQSSASPVAVQEEKLDRFTEDG
FSGSGRISNSGYGDSGANPHDISYEQPSIPPRTFRSEWIPREQPGLNRLSKSDDSAASQF
IMAHAYSEGSQQIIESVNKLNDGNVAPQTEHFVPSGRSLSANLHATADKGVKLQESQGLS
VSAREVDTKFSGELSEANYKPELKAATYAEKVKSGLSDPILSNNIQAESASRKTELHWGD
ASSHRAEGNEEAEQLNSLAEKECQVGAAVSTGIPSGTVGTLEHGSILFDINDRFPHDFLA
DIFSKAKLMDASPVPAPLYSDGTGLSLNMENHEPKNWSFFQKIAQGDFDRRNVSLMDQDH
LCVSSTRANVDDGVSMDYGYPPFKGDGAMIDHMDSQLNIEAEFQQASPEIVVPDTMDLPS
GYNPSQITDVESMQYDVELSSKVPESGYQDENQGAQNAGFPLTNLPLGDFDPSSLQIISN
EDLEELKELGSGTFGTVYHGKWRGTDVAIKRIKKSCFTGRSSEQERLTVEFWREAEILSK
LHHPNVVAFYGVVKDGPGGTLATVAEFMVNGSLRHVLLCKDRHLDRRKRLIIAMDAAFGM
EYLHSKNIVHFDLKCDNLLVNLKDPSRPICKVADFGLSKIKRNTLVTGGVRGTLPWMAPE
LLNGGSNKVSEKVSFQFLFYV
Download sequence
Identical sequences K4B5D3
Solyc02g031860.2.1 Sopim02g031860.0.1 Solyc02g031860.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]