SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g036360.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g036360.1.1
Domain Number 1 Region: 34-168
Classification Level Classification E-value
Superfamily TPR-like 4.85e-25
Family Tetratricopeptide repeat (TPR) 0.0013
Further Details:      
 
Domain Number 2 Region: 277-347
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.0000000000000105
Family PB1 domain 0.0096
Further Details:      
 
Domain Number 3 Region: 487-630
Classification Level Classification E-value
Superfamily TPR-like 0.00000841
Family Tetratricopeptide repeat (TPR) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g036360.1.1
Sequence length 761
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch02 gene_region:21284150-21286435 transcript_region:SL2.40ch02:21284150..21286435- go_terms:GO:0005488 functional_description:"At1g62390-like protein (Fragment) (AHRD V1 *--- C0JCT4_9BRAS); contains Interpro domain(s) IPR011990 Tetratricopeptide-like helical "
Sequence
MGKSGGRKKKGQNQGENHKPVVNGTVDLDSSIFLKRAHELKEEGNKRFQAKDFVGALQQY
DNALKLTPKTHPERAVFHSNRAACMMQMKPIDYDSVISECTMALQVQPRFVRALLRRARA
LEAVCKYEMAMQDVQMLLDADGNHQDALEIAGRLSMILGPRQDAQQDLQSRPSPAALGAS
AVGAASIAGLGPCLPSRSMSKKPVPSTGAMVVSVNSKPNKPSYVMPAENGTQAKVQLPRV
SLKPSTGPSKPNVSPSRDDQKENASTSASITVHGHSKEAVSRWRPLKLVYDHDIRLAQMP
VNCSFRVLRDIVMKRFPMSKSVLVKYKDSDGDLVTITCTAELRLAESWVDSLVPKDPDAD
EGDFIGMLRLHIVEVSPEQEPALLEEEERPVESEENIADESVSHSSLSDSVVETLESEIN
KSEKGITKEKTITEGPECKEVEMDDWLFEFAQLFRTHVGIDPDAHIDLHELGMELSAEAL
EETVTSEAAQALFDKAALKFQEVAALAFFNWGNVHMCAARKRMPIDDSASKETMAIKLQA
AYDWVKEKYSLAKEKYEEALSIKPDFYEGLLALGQQQFEMAKLHWSFVLAKKEDLSSWDR
TETLALFESAEEKMKAATQMWEKLEELRDNELKDPSTIKKDELLRRKKKQGSGPEGEVSA
TGGPGEISADEAAQQAAVMRSQIHLFWGNMLFERSQVECKLGLIGWKEKLDTAVERFKLA
GASEIDISTVLKNHCSNEEATQGSQEMVESLKTEGNDNPND
Download sequence
Identical sequences K4B5S9
Solyc02g036360.1.1 NP_001266032.2.44838 Solyc02g036360.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]