SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g078470.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc02g078470.2.1
Domain Number - Region: 20-100
Classification Level Classification E-value
Superfamily TPR-like 0.00026
Family Tetratricopeptide repeat (TPR) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g078470.2.1
Sequence length 105
Comment genomic_reference:SL2.40ch02 gene_region:37715585-37718968 transcript_region:SL2.40ch02:37715585..37718968+ functional_description:"Unknown Protein (AHRD V1)"
Sequence
MTQVSLVIQLALGSARDADKVFLAAIDKFDAMISRGNVYAPDALFRWATALQHRSRLRPR
TSREKVKLLQQAQRLYKDALHMDSDNLQARKALSSCISELKYWYR
Download sequence
Identical sequences K4B971
Solyc02g078470.2.1 Sopim02g078470.0.1 Solyc02g078470.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]