SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g079360.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g079360.1.1
Domain Number 1 Region: 27-120
Classification Level Classification E-value
Superfamily CAD & PB1 domains 3.6e-23
Family PB1 domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g079360.1.1
Sequence length 385
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch02 gene_region:38533196-38534353 transcript_region:SL2.40ch02:38533196..38534353+ functional_description:"Octicosapeptide/Phox/Bem1p domain-containing protein (AHRD V1 *--- D7L8F8_ARALY); contains Interpro domain(s) IPR000270 Octicosapeptide/Phox/Bem1p "
Sequence
MYDDTTATQPRARFMCSFGGKIVLRPHDNQLRYVGGDTRIVAVNRHTTFAALLGKLSKLI
GYPNINIKYQLPNEELDALITVTTDEDLENMMEEYDRLTQNQKSARLRLFLFPNDSGSRA
STISSILDGSSKREQWFVDALNGGAGPGLERGRSEVSSIVSEVPDYLFGLDNSDDPPRES
KFVKNKIISEPGSPAPPIVSSPYCSISSSSMTPTAAMTVMPDLPPVKTKLDKPNPTAESR
ETPVASATETGERTVQQQQQSYPSSPLWHYPAPPVQTIPVYYVPGSVQPGNIPVQPITLR
APYIHPFPVPPNQLPVGYPPASSMGQVYSGLRPVMSVDPNELRVVTEGMNYYAVRNSGVV
PGYGGPVSEEMQGSGGDGMSGRVSQ
Download sequence
Identical sequences K4B9G0
Solyc02g079360.1.1 Solyc02g079360.1.1 Sopim02g079360.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]