SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g081200.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g081200.1.1
Domain Number 1 Region: 44-178
Classification Level Classification E-value
Superfamily TPR-like 4.43e-28
Family Tetratricopeptide repeat (TPR) 0.00072
Further Details:      
 
Domain Number 2 Region: 291-357
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000016
Family PB1 domain 0.0084
Further Details:      
 
Domain Number 3 Region: 499-593
Classification Level Classification E-value
Superfamily TPR-like 0.0000664
Family Tetratricopeptide repeat (TPR) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g081200.1.1
Sequence length 778
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch02 gene_region:39832231-39834567 transcript_region:SL2.40ch02:39832231..39834567- go_terms:GO:0005488 functional_description:"At1g62390-like protein (Fragment) (AHRD V1 *--- C0JCT1_9BRAS); contains Interpro domain(s) IPR011990 Tetratricopeptide-like helical "
Sequence
MGKSGGRKKKAGISQNQNQNQGAVGNSHSPVVNGSVDLDSSIFSKRAHELKEEGNKRFQA
KDYVGALEQYENALKLTPKTHPDRAVFHSNRAACLMQMKPIDYDSVVSECTMALQVQPSY
VRALLRRARAFEAVGKYEMAMQDVQILLGADPNHRDALEIAGRLRMALGPRPEAQQDLQS
RPSPAALGASAVGAAPIAGLGPCLPARPMSKKPAPLGGASAISVNNKPEKPYQVTPAENG
PHAKVQLPKVVLKPANGPSRPHADRNKDGQREKASLSASSAVHGHSKDVAIRWRPLKLVY
DHDIRLAQMPVTCSFRVLRDIVSKRFPMSKSVLVKYKDSDGDLVTITCTAELRSAESWVD
GLLPKDPDADKTGAIGLLRLHVVEVSPEQEPALLEEEEEKPVESEGSKGDDSGSHSSISD
LVVETVDNESNKAEKVTITEKAATAENPDCKEVEMDDWLFEFAQLFRTHVGIDPDAHIDL
HELGMELCSEALEETVTSEEAQVLFDKAALKFQEVAALAFFNWGNVHMCSARKRIPIDDS
ASKEMMATQLQAAYDWVKEKYSLAKEKYEEALLIKPDFYEGLLALGQQQFEMAKLYWSFI
LAKKEDLSNWDPTETLALFDSAELKMKAATEMWEKIEEQRANELKDPSTSKKDELLRRRK
KQASGPESEASAVAGPAEISADEAAEQAAVMRSQIHLFWGNMLFERSQVECKLALDGWKK
NLDTAVERFKLAGASESDISTVLKNHCSNEEAAEGSKQMVESLNTDAAANHKNDASQA
Download sequence
Identical sequences K4B9Z0
Solyc02g081200.1.1 XP_004232679.1.44838 Sopim02g081200.0.1 Solyc02g081200.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]