SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g083610.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g083610.2.1
Domain Number 1 Region: 114-135
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000123
Family Formin homology 2 domain (FH2 domain) 0.06
Further Details:      
 
Weak hits

Sequence:  Solyc02g083610.2.1
Domain Number - Region: 505-631
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0345
Family IMD domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc02g083610.2.1
Sequence length 637
Comment genomic_reference:SL2.40ch02 gene_region:41533936-41536777 transcript_region:SL2.40ch02:41533936..41536777- go_terms:GO:0003677 functional_description:"BZIP transcription factor (AHRD V1 *-*- D3YBE4_TRIRP); contains Interpro domain(s) IPR006867 Protein of unknown function DUF632 "
Sequence
MGCWYSRLEREELVSRCKARKRYMKQLVKSRQAFSASHSMYLRSLRNTGSALLQFATGET
DLHPQNHHLPPLPPSPPRRLTTPHPPPPPPPPPPPMSPTSWTTSTTTSSALPPPPPPPPP
PPPPATSNWDFWDPFVPPPSSSRSVTEEEWDETTITSEAAVTTTVGAASVAAPPSAVSQF
SKETTSTSELAVVVSTKGKDLVEIIKELDEYFLNAADAGAQLSLLLEVPNCAFSEQRSSD
KLMSPFSWSFGGSSRWNGIGRFCDDPMNKSINGVNGAKAASHCSTVERLYAWEKKLYLEV
KHAEALKLEHEKRGGHARKLEMKRADYVKTEKAKKEVEKLESQMMVAAQAIETTSAEIIK
LRESELYPQLVDLVKGLMYMWRSMYECHHVQTHIVQQLKYLNTVPSTYPTSELHRQSTLQ
LELELEQWHLSFCNLVKFHRDYIQSLTGWLRLSLFQLGNNPVHKTSQDNAVYSLCEEWHL
AVNNAPDKVASEGINSLLTVIHAIVVQQSEEIKQKKKSEMAFKELDKKSSELRSLESKYG
PYSIPDSSSSSTRNKNPVTDKRAKVDAIRAKAEDEKAKYDKAVSVTRAMTLNNLQMGLPH
VFQAVTGFANVWTHAFESVYNQAKNTDQVHEMKRILP
Download sequence
Identical sequences K4BAM9
Solyc02g083610.2.1 NP_001315266.1.44838 Solyc02g083610.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]