SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc02g094410.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc02g094410.2.1
Domain Number 1 Region: 30-220
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 1.09e-22
Family BAR domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc02g094410.2.1
Sequence length 625
Comment genomic_reference:SL2.40ch02 gene_region:49518515-49525760 transcript_region:SL2.40ch02:49518515..49525760+ functional_description:"Hydroxyproline-rich glycoprotein family protein (AHRD V1 ***- D7LGA9_ARALY)"
Sequence
MKSSFGKLKKFALHKDKKDHQILLHLDGLSQASQDMKDMRDCYDSLLSAAAAAANSAYEF
SESLMEMGTCLLEKIALNGDGENRKAMSMLGGVQLELQKFVDCYRSHIILTITNPSESLL
SELRKVEEMKLQCDEKREVYEYMANRGKGGKGENFTSQQLQAAREDYEEMARLCIFRVQS
LKQGQCRSLLTQAARHHGAQLNFFRKGLKSLESVEPQIRMVAENQHIDYQPVELDDSEDG
GKSYEANDDGELSFDYRKNKQEPNDSFPMRDSMEFDPADAPSTLTSGMEEVELDLGRNQE
QVFTRQPRVVSHSAPIFAEKSDISDRIKQAQTSARKFHTYALPTPADAKSLTSRTSVSLQ
HSSTMNTSGGSNNPWHSSPLNMDKYSKFSDDNLSTDTLAKGQSTAQEIKDHTFSTPLPPP
LAEGTSLPQNDIQNGIDARKMRRLAFSGPLASKPSSSKPLLSASGPIGLAERPLLEPGLA
SGIPISQPPSTLDVSYSASPPLVSSPKISELHELPRPPGILASKPSSSTAFGHSAPLVNR
NQETSPTNQSPVLASNTGSPLPLPPLTIPRSFSIPSNNQRAMALHVAQLLESPQRKGKGD
VMCSPPLTPLSLSNTSNSGQIRGRS
Download sequence
Identical sequences K4BDN6
Sopim02g094410.0.1 Solyc02g094410.2.1 Solyc02g094410.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]