SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g019680.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g019680.2.1
Domain Number 1 Region: 58-175
Classification Level Classification E-value
Superfamily CBS-domain pair 8.97e-25
Family CBS-domain pair 0.0006
Further Details:      
 
Domain Number 2 Region: 234-348
Classification Level Classification E-value
Superfamily CBS-domain pair 1.39e-22
Family CBS-domain pair 0.00093
Further Details:      
 
Domain Number 3 Region: 407-497
Classification Level Classification E-value
Superfamily CAD & PB1 domains 2.05e-17
Family PB1 domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc03g019680.2.1
Sequence length 551
Comment genomic_reference:SL2.40ch03 gene_region:6629630-6635879 transcript_region:SL2.40ch03:6629630..6635879- functional_description:"CBS domain containing protein (AHRD V1 ***- B6U1W0_MAIZE); contains Interpro domain(s) IPR000644 Cystathionine beta-synthase, core "
Sequence
MTTSHGGGSLSRRSSLSLTSSTSNLKKKAAAHENGGGQPDSGTRKSMSLSRSMGLTGERT
VKRLRLSKALTVPDSTSIYEACRRMAARRVDALLLTDSNALLCGILTDKDIATRVIAREV
NIQETPVSKIMTKNPVFVLSDTLAVEALQKMVLGKFRHLPVVENGEVIALLDIAKCLYDA
IARLERAAEKGKAIAAAVEGVEKHWGSSVSGSNTFIETLQERMFKPSLSTIISENSKVVI
VEPSDTVLATAKKMLESRTSSAIVMVDNKPRGILTSKDMLMRVIAQDLSPESILVERVMT
PSPECSTTDTPIVDALHTMHDGKFLHLPVVDKEGTVVAVLDVLHITHAAVSTVGQNAGPN
NEAANTMMQRFWDSAMALTPDDDEETRSEGSLKLASEGAETGRSNLYPSASLPNTFAFKI
QDRKGRMHRFNCDIRSVTDLITSIIQRLGNDIDRNNLPQILYEDEDQDKVILASDSDLTA
AVEHAKLSGWKGLRLHLDYSGTPGRRRGSNSESLDYAHPESAWASAYTAVAAGAALAASL
GVFAFLRRSGE
Download sequence
Identical sequences K4BEU0
Solyc03g019680.2.1 Solyc03g019680.2.1 Sopim03g019680.0.1 XP_004234305.1.44838 XP_015070313.1.21931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]