SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g025450.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g025450.2.1
Domain Number 1 Region: 416-684
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.46e-56
Family Protein kinases, catalytic subunit 0.00021
Further Details:      
 
Domain Number 2 Region: 708-786
Classification Level Classification E-value
Superfamily RING/U-box 1.06e-23
Family U-box 0.0031
Further Details:      
 
Weak hits

Sequence:  Solyc03g025450.2.1
Domain Number - Region: 28-139
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000385
Family Universal stress protein-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc03g025450.2.1
Sequence length 787
Comment genomic_reference:SL2.40ch03 gene_region:7242406-7250906 transcript_region:SL2.40ch03:7242406..7250906- go_terms:GO:0006468,GO:0000151 functional_description:"Receptor-like protein kinase (AHRD V1 *-*- Q9FZP2_ARATH); contains Interpro domain(s) IPR002290 Serine/threonine protein kinase "
Sequence
MSGEDMIKAEGICDVEDTVFVAVGKNVKEGKSVLSWALKSFAGRRICVLHVHQPNHLFSS
KDGKLSGAKLKQHMVKACQELDRLRLHKLLNQYLLFISQAGIQGGKVWLEINNVEKGIIH
IIEEHKIRWLVMGAAAETHYSKQLSELKSSKAKFVCQHAPMHCQIWFTCNECLIHTRSMK
NSLSSSSESLSSPEDNGGTEMRNNVGNGYEDLNILENASIPANKIVKVEIKGDYSTLHEA
HLHCATSQPLLEEGSFHGKASNDERSRVEQAMMDAENSKQRALEESVKRWRAEEDAREAI
SMAEASYRLFEEKQVQRKEKEEIFAKQKEEIEELKIQHDLCLNKLQMIQEKKPVLESQIT
ESSCAGKELEEKIIQAVELLISFRKQRDEMQIERDNAIKQVNRFRKLVQDDADEYCIKNF
FSISFSDIIEATQNFDPSSKIGEGKFGSVYKGMIHDVKVAIKMLPACGSFSDLDFQHKAE
SLSRVRHPNLVTLIGICSESRSLAYEFLENGNLEDHLACRKKSRPLHWQHRIRIAVEICS
ALIFVHANDPCIVHGNLRPTNILLDAKFVSKISDFGVHLLISQTENSNNDDPEASVYVDP
ECIDKRQLTVESDVYSFGVILLRLLTARPASGIVREVKCALESGNLGSVLDSSAGDWPIE
QVELLAYLALSCCEKDPLNRPNMLSEVWPTIEPMRDICKPNSDLNTSSQGSKSQKRIPPH
FVCPIFQDVMEDPHIAADGYTYEGDAIKGWLYSGHDTSPMTNLKLDTCDLIPNYALYRAI
QEWQQQS
Download sequence
Identical sequences K4BF18
Sopim03g025450.0.1 Solyc03g025450.2.1 Solyc03g025450.2.1 XP_010317616.1.44838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]