SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g046590.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc03g046590.2.1
Domain Number - Region: 417-524
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0453
Family BAR domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc03g046590.2.1
Sequence length 801
Comment genomic_reference:SL2.40ch03 gene_region:17160415-17182028 transcript_region:SL2.40ch03:17160415..17182028- functional_description:"Genomic DNA chromosome 5 TAC clone K15E6 (AHRD V1 ***- Q9FMB4_ARATH)"
Sequence
MAGSVQPEAILEWLQKEMGYQPLGSYAASSKAAMPTIDSLRKICRGNMIPIWNFLLNRVK
SEKTVEKVHRNILVHGRDDGNGNGNVNAVDSGRSKGRRKEKVGVVRDSGSGSSSSVGLAS
AENSREFALQERDLAEKEVERLRQIVRRQRKELKARMLEVSREEAERKRMLDERSNYRHK
QVMLEAYDQQCEEAAKIFSEYHKRLSYYINQARNVKRSSVDSSAEVVTTFQANEKDVYST
SKGTKSSEDVILIETTWERDIRKACECLAMQMAEKIRNSFPAYEGNGIHMNSLLQAAKLG
IDLDGDLPDEVRDAIVSCLKSPPQLLQAINAYAQKLKTTITREIEKVDVRADAEILRYKY
ENDRVMDASSPDVTSPLHYQLYGNGKIGGDTSSKGSQNQLLERQKAHVQQFLATEDALNK
AAEARKMSQQLLKRLQGTDDAISTHSLAIGGTSKSMSSLKQLELEVWTKEREAAGLKASV
NTLMSEIQRLNKLCAERKEAEDSLRKKWKKIEEFDARRSELESIYSALLKASMDAAAFWG
QQPLAAKEYSSSTIIPACTVLVDLSHSAKDLIEQEVSAFYQTPDNTLYMLPSTPQALLES
MGVGGSTGPEVVAAAEKNAAILTARAGARDPSAIPSICRISAALQYPAGLDASDAGLAAV
LESLGFCMKFRGSEASILEDLEKAINLVHTRRDLVESGRALLDHANKAQNEYERTTNYCL
SLAADQEKTATENWLQELDVAIGNAKHCLDEECKYVRGLVDEWWEQPASTVVDWVTVDGQ
NVAAWWNDVKQLMAFHDQQLR
Download sequence
Identical sequences K4BGG4
Solyc03g046590.2.1 XP_004234704.1.44838 Solyc03g046590.2.1 Sopim03g046590.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]