SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g058310.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc03g058310.1.1
Domain Number - Region: 15-54
Classification Level Classification E-value
Superfamily TPR-like 0.00873
Family Tetratricopeptide repeat (TPR) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc03g058310.1.1
Sequence length 230
Comment evidence_code:10F0H1E0IEG genomic_reference:SL2.40ch03 gene_region:21129838-21130829 transcript_region:SL2.40ch03:21129838..21130829+ functional_description:"Pentatricopeptide repeat-containing protein (AHRD V1 ***- D7MJP3_ARALY); contains Interpro domain(s) IPR002885 Pentatricopeptide repeat "
Sequence
MGREVHSLVEQVVFWDNLSVWNVLVDIYIKCGRMDKARSAFEKMIDRDVMQLEGVKPNIV
TLAALLAACASLPHLRLGKCRMAGLSGWTFRLQVDVNVETRLIDMYAKYNCFRLGYQVFT
KTSKKRTELARETSKKRTKLAREVVELFKFMLLDVVKPNDATLKSVLPAFVIEVDPRQAL
SMHNYLVRSGFVTRTEVATGLFDIYSKCGNLDNGQKIFNGIPKKERDIIL
Download sequence
Identical sequences K4BGN3
Solyc03g058310.1.1 Solyc03g058310.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]