SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g071740.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc03g071740.1.1
Domain Number - Region: 224-258
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0262
Family BAR domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc03g071740.1.1
Sequence length 379
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch03 gene_region:41454575-41456887 transcript_region:SL2.40ch03:41454575..41456887- functional_description:"Ulp1 protease family C-terminal catalytic domain containing protein (AHRD V1 ***- Q60D46_SOLDE)"
Sequence
MEILYFINTFLLCHLGETFICIEEFLMVEDGRYELYPWVQIAFNKLITSLMQDFNQNKKI
YRLFGMPYALNVWIYECASSLSPEFVVKVANGIPRICNWTVVAVKPKYEKFMFNIFSEAN
ITELSTTLVAAKKVQTKDKSDFEDFSTIPPGHLLRRSSRVSDISSPPPPKRRKNLDTHKT
KGSKPLSEQLSPPLNQSFPMPVEEPTLPANVSSVHVSSQVPKDKFVYRDIEELKQHMKEY
VDSKFEYLVNLIKANHFEVMNSRNREDDQQSKFSDKEGNDHQATFLIQMKFANNYQNIVV
ADFDVDDQAEDTLKNHQVMKDVSELQFPDANSHHTAETSEHKKELTDSQGFLSDSQSPID
IPITYIVVRSDINTPHARI
Download sequence
Identical sequences K4BHK3
Solyc03g071740.1.1 Sopim03g071740.0.1 Solyc03g071740.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]