SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g093100.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc03g093100.1.1
Domain Number - Region: 704-739
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.0103
Family Retrovirus zinc finger-like domains 0.006
Further Details:      
 
Domain Number - Region: 29-86
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.053
Family PB1 domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc03g093100.1.1
Sequence length 743
Comment evidence_code:10F0H0E0IEG genomic_reference:SL2.40ch03 gene_region:47724295-47726785 transcript_region:SL2.40ch03:47724295..47726785- go_terms:GO:0008270 functional_description:"Mutator-like transposase (AHRD V1 ***- Q9FH43_ARATH); contains Interpro domain(s) IPR018289 MULE transposase, conserved domain "
Sequence
MTNIAVMLYFNGRWDPSNKYINYLADGVLIHTESTFATLVSVIATQLSIDTSTSKVEIRY
KIDERSPPIQIHNDMGVKVYLETKKEHRDMTRYPLCVTTTEPVNLETNAALIPLLCSDTS
GDMRVIHNSYFSNTFNGIDEAIGLIGFGSCEEVDELEELAPGIIINPNHSLFEKDQVYKN
KYVLTSALKRHSILNHFQFKTTRSSAISYSIQCLGESCSWSLRASSLNKSEMFKIREFES
EHTCLLLHNSLSERLATKSVVGSIIVGKYAEPDANYTPKDIQHDMLAEYGVRLTYMQAWR
AKEAALELIRGDPIQSYAKLPSYFHILEATYPGSHIRFHKSEDDRFLYAFVALFTSIKGW
EYCRPIVVVDGTFLKGAYKGTLLTANTLDAAGSILPLAYAIVDSENDSSWGWFFEQFRDA
FGQRPEMCIVSDRHASIIKAVSTVYDEVPHFACMWHLLQNIMKNFRRSQQRVTELFYSMA
KTYTMTEFNQCMTMVEKIDKRIKDYLLNIGYNKWSRVHAEVNRTWMMTSNIAESVNSRTR
HAKVLTVLQLLEFMRQLVQKWNNNNRSKATFSGFHLGKKYENILRRNKTASEKLKVVETN
KYVYTVLDGITQFTVCLHQRTCTCGRFQLDELPCPHALAVLTIKHTGYEKYCSAYYTRKN
LLLTYQFQMDPLPNESTWNTPTHVLQDIVLPPHGKRPPGRPKNKRHTQLREDGFKKAKIT
CSNCGQHDHNRKTCKNVRPYDQE
Download sequence
Identical sequences K4BII7
Solyc03g093100.1.1 Sopim03g093100.0.1 Solyc03g093100.1.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]