SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g112230.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g112230.2.1
Domain Number 1 Region: 2-85
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000000000028
Family PB1 domain 0.0056
Further Details:      
 
Domain Number 2 Region: 436-495
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000006
Family ZZ domain 0.0085
Further Details:      
 
Domain Number 3 Region: 823-860
Classification Level Classification E-value
Superfamily UBA-like 0.0000000887
Family UBA domain 0.0066
Further Details:      
 
Weak hits

Sequence:  Solyc03g112230.2.1
Domain Number - Region: 766-818
Classification Level Classification E-value
Superfamily UBA-like 0.000172
Family UBA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Solyc03g112230.2.1
Sequence length 864
Comment genomic_reference:SL2.40ch03 gene_region:56747879-56752208 transcript_region:SL2.40ch03:56747879..56752208- go_terms:GO:0008270 functional_description:"ZZ type zinc finger domain-containing protein (Fragment) (AHRD V1 *--- C1GFD2_PARBD); contains Interpro domain(s) IPR000270 Octicosapeptide/Phox/Bem1p "
Sequence
MAMESSIVIKVKYEETLRRFNACVINEKLDLDIGGLRDKIIRLFNFAHDAEITLTYIDED
GDVVTLVDDADLQDVVRQDLNPLRISARLNAAERSGRASARSSGNSTPLRSPRVQPPFLN
LNSRVSDVLKYIPEPLRESVMKVCSDVTASASSSAPILAELVDAMCELGLSHYQNQVSGP
QPVKEAGSCSGISKGNAMSADGVMPNVKIGESSAKKNGPLTAVHGEEPTLKTTEPKPNAS
NAAVDASVKLVSKSETLEGDRTKAQSSSFEASKAQKDKKFDVRSLDGRTIGYGYARNSPI
PPEKTSDEQPSKGHPVAKPVDLGGSASSSNVKQCNWDSLNADSSGSLINIPYDGFTPSHV
VHLNTVNVNDSHNAGSSGSSMKMPYDGYIPAVRHLGPLIPVNACPFSGMPTENNPIPPQN
FSFEVPLKRSHNHSDGTGTIFHKGVRCDGCGVHPITGPRFISKVKENYDLCSICFAEMGN
DADYFRMDRPLTYPHPWSFKGLHDLHGRLRPRPPTVPQVIRGFGLKAGRPKLDSRFIQDV
NVLDGTIMAPLTQFTKIWRMKNNGNLVWPQGTQLVWIGGDKLSDRFSVELEMTTAGLAVD
QELDVAVDFAAPEHPGRYISYWRLASPSGQKFGQRVWVLIQVDALLSLPKRGLVHEAFQG
LNLNLPPASSGVSGADIINVNSEPHNVVPEPKSSNTMELVDSVAEVNQNMEQEVKFPIND
SLLVGFGDKSSSPSASGSTISYPIIDLTKEPPSEDSSMQPSAVVAMQAPPLQDARGNFEV
ETSLLQELEEMGFKQVDLNKEILRKNEYDLEQSVDDLCGVAEWDPILEELKDMGFCNKEM
NKKLLKKNNGSIKRVVMDLIAGEQ
Download sequence
Identical sequences K4BK77
XP_010319017.1.44838 XP_019068576.1.44838 Solyc03g112230.2.1 Solyc03g112230.2.1 Sopim03g112230.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]