SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g117860.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g117860.2.1
Domain Number 1 Region: 106-163
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000106
Family RING finger domain, C3HC4 0.0088
Further Details:      
 
Domain Number 2 Region: 43-101
Classification Level Classification E-value
Superfamily RING/U-box 0.0000187
Family IBR domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc03g117860.2.1
Sequence length 166
Comment genomic_reference:SL2.40ch03 gene_region:60930998-60932206 transcript_region:SL2.40ch03:60930998..60932206- go_terms:GO:0008270 functional_description:"IBR finger domain protein (AHRD V1 **-- Q4WL53_ASPFU); contains Interpro domain(s) IPR002867 Zinc finger, C6HC-type "
Sequence
MSLHYLTSDAKLAEELQKQFVIAESLQIFARYERGLIESAIPNREKLYCPYKKCAKLLSH
DPDDDEEIVMKGKCPWCAGLLCARCRVPWHTGRDCQQFQEEEKDREDDLRVKLLAENHKW
KNCPHCNSLVDKVDDGCVHITCRCNEEFCYACGATWSKRHWNCQTR
Download sequence
Identical sequences K4BLT7
Sopim03g117860.0.1 Solyc03g117860.2.1 XP_004235872.1.44838 Solyc03g117860.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]