SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g118260.1.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g118260.1.1
Domain Number 1 Region: 11-246,292-317
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.81e-57
Family BAR domain 0.002
Further Details:      
 
Domain Number 2 Region: 497-636
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 1.12e-36
Family Pyk2-associated protein beta ARF-GAP domain 0.00038
Further Details:      
 
Domain Number 3 Region: 261-328,371-432
Classification Level Classification E-value
Superfamily PH domain-like 1.43e-23
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 4 Region: 657-676,705-795
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.89e-22
Family Ankyrin repeat 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc03g118260.1.1
Sequence length 800
Comment evidence_code:10F0H1E1IEG genomic_reference:SL2.40ch03 gene_region:61224742-61239157 transcript_region:SL2.40ch03:61224742..61239157+ go_terms:GO:0005515 functional_description:"Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 (AHRD V1 *--- AGAP3_MOUSE); contains Interpro domain(s) IPR001164 Arf GTPase activating protein "
Sequence
MQEGKTLFARIDDSPMFRQQIQSLEESSETLRDKCLKYYKGCRKYTEGLGEAYDKDIAFA
SSLETFGGGRNDPISVAYGGPDMAKFATALREIGTYKEVLRSQVEHVLNDRLLHLATIDL
PDVKEARKRFDKANVAYDQVREKFLSLRKSTRMDIAAAIEEELYNARLSFEQARFNLVGA
LSAVEAKKKYEFLEAVGSMMDSHLRFFKQGYEVLHQMEPYISQVLAYSQKARESSMYEQA
ALNERMQEYKKKIDQERRCSFNGSTNGDVTQPFSRSSHKLIEAVMQSASEGKVQTIKQGY
LSKRSSNIRGDWKRRFFVLDSRGMLYYYRKQLSRPSFQGSASPLLSNRCSSPEPGSGLLS
RWLSSHYHGGVHEEKSVARHTVNLLTSTIKADADQSDLRFCFRIISPTKNYTLQAESAAE
QMDWIEKITGVITSLLTSQTPERHFSVSPISESSSIGSPIDHDQRAMEEYTSGRDLTGRS
FMRPSKSSVHILSTKRERPVEALKRIPGNDKCADCGAPGPEWASLNLGLLICIECSGVHR
NFGVHISKVRSLKLDVKVWGPSIITLFEALGNVFVNSVWEELLHARKTFQADEIPMRFFE
SDKHKEFFGKPSYADHISVKEKFIHAKYAEKRFIHKVKDTTHLLSVAEQLWEGVRANDKK
AVYRLIVVYQADVNAVHGEEASPGSDSSSSFNPQSESEEHCIDEFLDGCSLLHLASQTAD
IGMVELLLQYGANINACDSRGQTPLHHSVMRGRTATSKLLLARGANPHIADLEGKTPCHL
VSELALNDVEILALLKVANR
Download sequence
Identical sequences K4BLX7
Solyc03g118260.1.1 Solyc03g118260.1.1 Sopim03g118260.0.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]