SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g120140.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  Solyc03g120140.2.1
Domain Number - Region: 58-189,216-276
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0105
Family BAR domain 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Solyc03g120140.2.1
Sequence length 287
Comment genomic_reference:SL2.40ch03 gene_region:62673416-62681136 transcript_region:SL2.40ch03:62673416..62681136+ functional_description:"Bzip-like transcription factor-like (AHRD V1 ***- Q7X997_ORYSJ); contains Interpro domain(s) IPR006867 Protein of unknown function DUF632 "
Sequence
MGCTLLINRLRDEQLYPKLVDLVNGMAIMWENMKGYHVSQSKIAQALKSLDISQSPKETT
EHHHERTLQLYVVVQEWHSQFDKLVIYQKQYIKALNNWLKLNLIPIDTNLKEKVSSPQRP
QNPPILALIHAWHDDLEKLPDELARTAIYNFSAVINTIFEYQKEEMKLRDRCEDTRRELN
KKTRQYEDWYHKHMQRRIPDEMDPESAQEDTLVVDRQLQLEALRKRLEDEEDSYQRQCLQ
VRDKSLTSLRSRLPELFGAMSEFSLACADMYRDLRSIAKHRNRSVNT
Download sequence
Identical sequences K4BMG3
Solyc03g120140.2.1 Sopim03g120140.0.1 Solyc03g120140.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]