SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc03g121440.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc03g121440.2.1
Domain Number 1 Region: 378-668
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.91e-77
Family Protein kinases, catalytic subunit 0.00019
Further Details:      
 
Weak hits

Sequence:  Solyc03g121440.2.1
Domain Number - Region: 15-162
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00157
Family Universal stress protein-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc03g121440.2.1
Sequence length 731
Comment genomic_reference:SL2.40ch03 gene_region:63606458-63610114 transcript_region:SL2.40ch03:63606458..63610114+ go_terms:GO:0006468 functional_description:"Receptor-like protein kinase At3g21340 (AHRD V1 *-*- RLK6_ARATH); contains Interpro domain(s) IPR002290 Serine/threonine protein kinase "
Sequence
MKKGKQDMSSDAAEKVMVAVKASKEIPKTALVWSLTHVVQPGDCITLLVVVPSQSSGRKL
WGFPRFAGDCASGHWKLHSGNSSEHKSDITDYCSQMILQLHDVYDPNKINVKIKIVSGTP
HGAVAAEAKKSQANWVVLDKHLKHEKKRCMEELQCNIVVMKRSQPKVLRLNLVGSPKKEP
DVTGTLSSEQTQICGKESNKKDSLDSSRGPLVTPSSSPEMFSTTEAGTSSVSSSDPGTSP
FFVSEVNRDLKKANLSSAQEDVDESSSESESENLSASSSLRFQPWIADIINSHSELSQIK
GKSSLRTHDRPQDSTNKTLLRKFSKLDEESDFGSPSYRADLDYSGNVREAVALSRSAPLG
PPPLCSICQHKAPVFGKPPRWFTYAELELATGGFSQANFLAEGGYGSVHRGVLPDGQVVA
VKQHKLASSQGDQEFCSEVEVLSCAQHRNVVMLIGFCIEDSRRLLVYEYICNGSLDSHLY
GRTRDPLEWSARQKIAVGAARGLRYLHEECRVGCIVHRDMRPNNILITHDFEPLVGDFGL
ARWQPDGDTGVETRVIGTFGYLAPEYAQSGQITEKADVYSFGVVLVELVTGRKAVDLTRP
KGQQCLTEWARPLLQECAVDELIDPRLENCYSEHEIYCMLHAASLCIRRDPQARPRMSQV
LRILEGDLIMESGKLSTTPGYDVGNHSGRIWSDAQQQCQRFSGSSDGSEEFSAKLSFDKR
NPSNVWDRSTY
Download sequence
Identical sequences K4BMU3
Sopim03g121440.0.1 Solyc03g121440.2.1 Solyc03g121440.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]