SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for Solyc04g007460.2.1 from Solanum lycopersicum v2.3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Solyc04g007460.2.1
Domain Number 1 Region: 89-182
Classification Level Classification E-value
Superfamily CAD & PB1 domains 7.85e-24
Family PB1 domain 0.0037
Further Details:      
 
Weak hits

Sequence:  Solyc04g007460.2.1
Domain Number - Region: 572-638
Classification Level Classification E-value
Superfamily Coproporphyrinogen III oxidase 0.0196
Family Coproporphyrinogen III oxidase 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Solyc04g007460.2.1
Sequence length 682
Comment genomic_reference:SL2.40ch04 gene_region:1123166-1125655 transcript_region:SL2.40ch04:1123166..1125655- functional_description:"Octicosapeptide/Phox/Bem1p domain-containing protein (AHRD V1 *--- D7L8F8_ARALY); contains Interpro domain(s) IPR000270 Octicosapeptide/Phox/Bem1p "
Sequence
MEPPLLPGPPISTTVTTAASVAGTMPQPTPPTASHINYANSVDSSPKSRKTNSWDEQQQQ
PPHAGGGGGSNVKIRLMCSYGGHIIPRPHDKSLCYIGGDTRIFVTDRNTSLSDLSSRLSK
TLLAGRPFWLKYQLPNEDLDSLISVTTDEDLENMIEEYDRVTKASRIRVFLFTSEFDSVS
SIGSLLQSSTKSEDWFVHALNGATSTSTTKVFSESSSVNCLLGLDDDVGNCNVKSVDGQL
EGSFGAKNVKISAHDVQSVPDSPMVETTSSFGSTSSTPSLTSLPPIKVHVEENQRIGIEG
QFSQLGVGGKVEQKQEERGFMGLTSPPAPAAPVVGTVYSGVPVVVGGDYSNRIFSDDERS
EQGVTAGYRNPVQTQPQPQPQQQQPKLVLPSDLPSPSSVSSESSVMSGQRHFFYQEPVGQ
IHSGNNRVSANSVDMKQSDPNNRAQVQQQQVQEAGYAMSVKYDQHQQMYQPQQYVHASQY
IHHTPSGSVPVTSYYPIYPSQQQTHPPHPALEHQYPVYIVHSRQPSQAYNLPVQQTNYSE
SAQTNVPSNQPQTPPAPSMAAPAAAYNHPGNPPASKPEMIAGAYRTAAAGTPQLVQITSG
QHQQQYVGYSQIHHPSQPIAPTSRATANYAYEFSDPTHAQIYYSQAHAPQFATQYQTMTS
SPAVGLHSTSSQLPTEKNQPTN
Download sequence
Identical sequences K4BNQ3
XP_004236976.1.44838 Solyc04g007460.2.1 Solyc04g007460.2.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]